Details of Drug-Metabolizing Enzyme (DME)

General Information of Drug-Metabolizing Enzyme (DME) (ID: DE017IC)

DME Name Alcohol dehydrogenase class-V (ADH6)
Synonyms Alcohol dehydrogenase 6; ADH6; ADH-5; Alcohol dehydrogenase 6 (class V)
Gene Name ADH6
UniProt ID
ADH6_HUMAN
INTEDE ID
DME0073
3D Structure
Download
2D Sequence (FASTA)
Download
3D Structure (PDB)
Download
Gene ID
130
EC Number EC: 1.1.1.1
Oxidoreductase
CH-OH donor oxidoreductase
NAD/NADP oxidoreductase
EC: 1.1.1.1
Lineage Species: Homo sapiens
Kingdom: Metazoa
Phylum: Chordata
Class: Mammalia
Order: Primates
Family: Hominidae
Genus: Homo
Species: Homo sapiens
Sequence
MSTTGQVIRCKAAILWKPGAPFSIEEVEVAPPKAKEVRIKVVATGLCGTEMKVLGSKHLD
LLYPTILGHEGAGIVESIGEGVSTVKPGDKVITLFLPQCGECTSCLNSEGNFCIQFKQSK
TQLMSDGTSRFTCKGKSIYHFGNTSTFCEYTVIKEISVAKIDAVAPLEKVCLISCGFSTG
FGAAINTAKVTPGSTCAVFGLGGVGLSVVMGCKAAGAARIIGVDVNKEKFKKAQELGATE
CLNPQDLKKPIQEVLFDMTDAGIDFCFEAIGNLDVLAAALASCNESYGVCVVVGVLPASV
QLKISGQLFFSGRSLKGSVFGGWKSRQHIPKLVADYMAEKLNLDPLITHTLNLDKINEAV
ELMKTGKW
Function This enzyme metabolizes a wide variety of substrates, including ethanol, retinol, other aliphatic alcohols, hydroxysteroids, and lipid peroxidation products.
KEGG Pathway
Chemical carcinogenesis (hsa05204 )
Drug metabolism - cytochrome P450 (hsa00982 )
Fatty acid degradation (hsa00071 )
Glycolysis / Gluconeogenesis (hsa00010 )
Metabolic pathways (hsa01100 )
Metabolism of xenobiotics by cytochrome P450 (hsa00980 )
Retinol metabolism (hsa00830 )
Tyrosine metabolism (hsa00350 )
Reactome Pathway
Ethanol oxidation (R-HSA-71384 )

Molecular Interaction Atlas (MIA) of This DME

Molecular Interaction Atlas (MIA) Jump to Detail Molecular Interaction Atlas of This DME
3 Approved Drug(s) Metabolized by This DME
Drug Name Drug ID Indication ICD 11 Highest Status REF
Abacavir DMMN36E Human immunodeficiency virus infection 1C62 Approved [1]
Ethanol DMDRQZU Chronic pain MG30 Approved [2]
NADH DM5NM6E Parkinson disease 8A00.0 Approved [3]

Molecular Expression Atlas (MEA) of This DME

Molecular Expression Atlas (MEA) Jump to Detail Molecular Expression Atlas of This DME
Disease Name ICD 11 Studied Tissue p-value Fold-Change Z-score
Acute myelocytic leukaemia 2B33.1 Bone marrow 8.26E-02 -5.77E-02 -4.33E-01
Alopecia ED70 Skin from scalp 7.97E-03 1.43E-01 6.56E-01
Alzheimer's disease 8A20 Entorhinal cortex 1.81E-01 -6.34E-02 -4.97E-01
Ankylosing spondylitis FA92.0 Pheripheral blood 2.21E-02 -1.09E-01 -1.66E+00
Aortic stenosis BB70 Calcified aortic valve 9.02E-01 1.18E-01 2.25E-01
Apnea 7A40 Hyperplastic tonsil 9.53E-01 -3.42E-02 -1.60E-01
Arthropathy FA00-FA5Z Peripheral blood 9.51E-01 2.53E-02 2.27E-01
Asthma CA23 Nasal and bronchial airway 1.49E-02 -2.97E-01 -3.47E-01
Atopic dermatitis EA80 Skin 1.42E-02 -6.67E-02 -2.94E-01
Autism 6A02 Whole blood 6.66E-01 6.55E-03 4.53E-02
Autoimmune uveitis 9A96 Peripheral monocyte 8.23E-02 -2.15E-01 -2.52E+00
Autosomal dominant monocytopenia 4B04 Whole blood 2.60E-01 2.81E-02 2.41E-01
Bacterial infection of gingival 1C1H Gingival tissue 6.91E-01 -6.45E-02 -2.65E-01
Batten disease 5C56.1 Whole blood 7.12E-01 -2.13E-02 -1.98E-01
Behcet's disease 4A62 Peripheral blood 8.44E-01 -9.27E-03 -5.13E-02
Bipolar disorder 6A60-6A6Z Prefrontal cortex 6.21E-01 -4.28E-02 -3.18E-01
Bladder cancer 2C94 Bladder tissue 8.68E-05 3.23E-01 1.91E+00
Breast cancer 2C60-2C6Z Breast tissue 4.35E-12 -1.13E-01 -3.66E-01
Cardioembolic stroke 8B11.20 Whole blood 1.73E-01 6.71E-02 4.62E-01
Cervical cancer 2C77 Cervical tissue 2.01E-02 -6.97E-02 -3.87E-01
Childhood onset rheumatic disease FA20.Z Peripheral blood 4.17E-01 4.61E-02 3.22E-01
Chronic hepatitis C 1E51.1 Whole blood 2.61E-02 1.24E-01 1.30E+00
Chronic obstructive pulmonary disease CA22 Lung tissue 7.81E-02 3.08E-02 2.30E-01
Chronic obstructive pulmonary disease CA22 Small airway epithelium 3.42E-02 3.16E-01 3.97E-01
Chronic rhinosinusitis CA0A Sinus mucosa tissue 2.14E-02 -1.08E+00 -1.52E+00
Colon cancer 2B90 Colon tissue 2.03E-71 -1.58E+00 -2.65E+00
Coronary artery disease BA80-BA8Z Peripheral blood 9.34E-01 -1.24E-02 -1.57E-01
Diffuse large B-cell lymphoma 2A81 Tonsil tissue 4.05E-01 -5.18E-02 -3.23E-01
Endometriosis GA10 Endometrium tissue 3.44E-01 9.10E-02 2.53E-01
Familial hypercholesterolemia 5C80.00 Peripheral blood 7.71E-01 -5.30E-03 -4.33E-02
Familial hypercholesterolemia 5C80.00 Whole blood 1.54E-05 -2.91E-01 -1.52E+00
Gastric cancer 2B72 Gastric tissue 1.25E-01 2.49E-01 5.94E-01
Glioblastopma 2A00.00 Nervous tissue 7.97E-20 -1.61E-01 -6.39E-01
Glioma 2A00.0Y-2A00.0Z Brain stem tissue 8.57E-01 -3.13E-04 -3.29E-03
Glioma 2A00.0Y-2A00.0Z White matter tissue 1.49E-04 -6.53E-01 -2.30E+00
Head and neck cancer 2D42 Head and neck tissue 6.98E-12 -3.37E-01 -2.52E-01
HIV-associated neurocognitive impairment 8A2Y-8A2Z White matter tissue 4.27E-01 -3.87E-02 -2.88E-01
Huntington's disease 8A01.10 Whole blood 8.70E-01 5.68E-02 4.03E-01
Idiopathic pulmonary fibrosis CB03.4 Lung tissue 9.34E-01 1.58E-01 3.47E-01
Immunodeficiency 4A00-4A20 Peripheral blood 8.99E-02 -1.84E-02 -5.15E-01
Influenza 1E30 Whole blood 2.75E-01 6.22E-02 5.98E-01
Interstitial cystitis GC00.3 Bladder tissue 1.12E-01 -8.09E-02 -8.47E-01
Intracranial aneurysm 8B01.0 Intracranial artery 9.70E-01 -2.45E-02 -1.69E-01
Irritable bowel syndrome DD91.0 Rectal colon tissue 7.07E-02 -2.03E-02 -5.99E-02
Ischemic stroke 8B11 Peripheral blood 3.26E-01 5.65E-02 5.86E-01
Juvenile idiopathic arthritis FA24 Peripheral blood 7.65E-07 1.01E-01 5.92E-01
Lateral sclerosis 8B60.4 Skin 7.22E-01 -3.01E-02 -3.11E-01
Lateral sclerosis 8B60.4 Cervical spinal cord 3.49E-01 3.62E-02 3.55E-01
Liver cancer 2C12.0 Liver tissue 7.31E-24 -1.50E+00 -2.23E+00
Liver failure DB99.7-DB99.8 Liver tissue 4.51E-03 -3.44E+00 -1.03E+01
Lung cancer 2C25 Lung tissue 2.40E-01 -5.78E-02 -1.70E-01
Lupus erythematosus 4A40 Whole blood 3.31E-01 -3.04E-02 -8.46E-02
Major depressive disorder 6A70-6A7Z Hippocampus 3.23E-01 2.29E-02 1.69E-01
Major depressive disorder 6A70-6A7Z Whole blood 2.39E-01 5.38E-02 2.61E-01
Melanoma 2C30 Skin 2.63E-01 -1.56E-01 -3.53E-01
Multiple myeloma 2A83.1 Peripheral blood 6.31E-01 4.38E-02 4.30E-01
Multiple myeloma 2A83.1 Bone marrow 1.10E-04 -2.60E-01 -2.14E+00
Multiple sclerosis 8A40 Plasmacytoid dendritic cells 8.53E-01 1.77E-02 6.17E-02
Myelodysplastic syndrome 2A36-2A3Z Bone marrow 2.28E-03 -6.17E-02 -5.88E-01
Myelofibrosis 2A20.2 Whole blood 1.45E-02 5.97E-02 5.46E-01
Myocardial infarction BA41-BA50 Peripheral blood 1.07E-01 2.66E-01 6.88E-01
Myopathy 8C70.6 Muscle tissue 3.77E-02 -8.13E-02 -6.79E-01
Neonatal sepsis KA60 Whole blood 1.32E-01 1.55E-02 9.13E-02
Neuroectodermal tumour 2A00.11 Brain stem tissue 4.88E-04 -7.10E-01 -1.64E+00
Non-alcoholic fatty liver disease DB92 Liver tissue 3.55E-01 2.04E-01 2.62E-01
Obesity related type 2 diabetes 5A11 Omental adipose tissue 6.07E-01 1.01E-01 9.11E-01
Olive pollen allergy CA08.00 Peripheral blood 1.01E-02 1.66E-01 1.91E+00
Oral cancer 2B6E Oral tissue 1.64E-07 -4.45E-01 -1.56E+00
Osteoarthritis FA00-FA0Z Synovial tissue 5.20E-01 -1.04E-02 -9.40E-02
Osteoporosis FB83.1 Bone marrow 4.82E-01 7.70E-02 9.93E-01
Ovarian cancer 2C73 Ovarian tissue 3.22E-01 -3.03E-01 -4.04E-01
Pancreatic cancer 2C10 Pancreas 3.03E-01 -1.81E-01 -4.71E-01
Parkinson's disease 8A00.0 Substantia nigra tissue 6.64E-01 -2.12E-02 -1.06E-01
Pediatric respiratory syncytial virus infection CA40.11 Peripheral blood 5.91E-01 1.25E-02 1.62E-01
Pituitary cancer 2D12 Pituitary tissue 4.65E-01 9.55E-02 5.06E-01
Pituitary gonadotrope tumour 2D12 Pituitary tissue 6.77E-01 6.37E-02 7.45E-01
Polycystic ovary syndrome 5A80.1 Vastus lateralis muscle 7.67E-01 3.57E-02 2.44E-01
Polycythemia vera 2A20.4 Whole blood 2.67E-03 8.13E-02 6.77E-01
Pompe disease 5C51.3 Biceps muscle 4.98E-01 -5.87E-02 -4.93E-01
Preterm birth KA21.4Z Myometrium 4.84E-01 -5.57E-03 -5.44E-02
Prostate cancer 2C82 Prostate 1.75E-01 -3.12E-01 -7.07E-01
Psoriasis EA90 Skin 3.78E-18 -3.02E-01 -1.20E+00
Rectal cancer 2B92 Rectal colon tissue 4.63E-05 -1.22E+00 -3.87E+00
Renal cancer 2C90-2C91 Kidney 3.78E-04 -1.67E+00 -1.89E+00
Retinoblastoma 2D02.2 Uvea 2.91E-01 -1.09E-01 -1.26E+00
Rheumatoid arthritis FA20 Synovial tissue 5.76E-02 -1.65E-01 -8.15E-01
Rhinovirus infection CA42.1 Nasal epithelium tissue 5.53E-01 -1.48E-01 -2.56E-01
Schizophrenia 6A20 Prefrontal cortex 9.94E-01 -1.37E-02 -6.19E-02
Schizophrenia 6A20 Superior temporal cortex 6.11E-01 -2.69E-02 -4.31E-01
Scleroderma 4A42.Z Whole blood 1.66E-02 8.04E-02 1.34E+00
Seizure 8A60-8A6Z Whole blood 5.37E-01 -3.52E-02 -2.40E-01
Sensitive skin EK0Z Skin 3.13E-01 1.27E-01 7.28E-01
Sepsis with septic shock 1G41 Whole blood 7.18E-03 3.38E-02 1.95E-01
Shwachman-Diamond syndrome 3A70.0 Bone marrow 1.40E-01 5.02E-01 1.34E+00
Sickle cell disease 3A51.0-3A51.3 Peripheral blood 8.02E-02 1.51E-01 7.98E-01
Simpson golabi behmel syndrome LD2C Adipose tissue 6.99E-01 4.27E-03 3.51E-01
Sjogren's syndrome 4A43.2 Salivary gland tissue 8.51E-01 5.31E-02 5.45E-01
Skin cancer 2C30-2C3Z Skin 3.61E-21 -3.32E-01 -1.01E+00
Thrombocythemia 3B63 Whole blood 1.40E-01 3.89E-02 3.43E-01
Thrombocytopenia 3B64 Whole blood 8.67E-02 1.56E-01 1.13E+00
Thyroid cancer 2D10 Thyroid 3.22E-04 7.38E-02 4.84E-01
Tibial muscular dystrophy 8C75 Muscle tissue 1.23E-02 -1.50E-01 -7.27E-01
Tuberous sclerosis complex LD2D.2 Perituberal tissue 5.44E-01 7.57E-02 9.54E-01
Type 2 diabetes 5A11 Liver tissue 7.59E-01 1.65E-01 8.96E-01
Ureter cancer 2C92 Urothelium 3.90E-01 -9.96E-02 -6.71E-01
Uterine cancer 2C78 Endometrium tissue 4.05E-05 -2.45E-01 -8.13E-01
Vitiligo ED63.0 Skin 2.09E-01 -7.97E-02 -8.77E-02
------------------------------------------------------------------------------------
⏷ Show the Full List of DME Expression Under 107 Diseases

References

1 A review of the pharmacokinetics of abacavir. Clin Pharmacokinet. 2008;47(6):351-71.
2 Functional assessment of human alcohol dehydrogenase family in ethanol metabolism: significance of first-pass metabolism. Alcohol Clin Exp Res. 2006 Jul;30(7):1132-42.
3 Conformational changes and catalysis by alcohol dehydrogenase. Arch Biochem Biophys. 2010 Jan 1;493(1):3-12.