Details of Drug-Metabolizing Enzyme (DME)

General Information of Drug-Metabolizing Enzyme (DME) (ID: DE073GW)

DME Name Glucosidase II beta (PRKCSH)
Synonyms Glucosidase 2 subunit beta; Glucosidase II subunit beta; Protein kinase C substrate 60.1 kDa protein heavy chain; 80K-H protein; G19P1; PKCSH; PRKCSH
Gene Name PRKCSH
UniProt ID
GLU2B_HUMAN
INTEDE ID
DME0546
3D Structure
Download
2D Sequence (FASTA)
Download
3D Structure (PDB)
Download
Gene ID
5589
EC Number EC: 3.2.1.84
Hydrolases
Glycosylase
O/S-glycosyl compound glycosidase
EC: 3.2.1.84
Lineage Species: Homo sapiens
Kingdom: Metazoa
Phylum: Chordata
Class: Mammalia
Order: Primates
Family: Hominidae
Genus: Homo
Species: Homo sapiens
Sequence
MLLPLLLLLPMCWAVEVKRPRGVSLTNHHFYDESKPFTCLDGSATIPFDQVNDDYCDCKD
GSDEPGTAACPNGSFHCTNTGYKPLYIPSNRVNDGVCDCCDGTDEYNSGVICENTCKEKG
RKERESLQQMAEVTREGFRLKKILIEDWKKAREEKQKKLIELQAGKKSLEDQVEMLRTVK
EEAEKPEREAKEQHQKLWEEQLAAAKAQQEQELAADAFKELDDDMDGTVSVTELQTHPEL
DTDGDGALSEAEAQALLSGDTQTDATSFYDRVWAAIRDKYRSEALPTDLPAPSAPDLTEP
KEEQPPVPSSPTEEEEEEEEEEEEEAEEEEEEEDSEEAPPPLSPPQPASPAEEDKMPPYD
EQTQAFIDAAQEARNKFEEAERSLKDMEESIRNLEQEISFDFGPNGEFAYLYSQCYELTT
NEYVYRLCPFKLVSQKPKLGGSPTSLGTWGSWIGPDHDKFSAMKYEQGTGCWQGPNRSTT
VRLLCGKETMVTSTTEPSRCEYLMELMTPAACPEPPPEAPTEDDHDEL
Function
This enzyme is a regulatory subunit of glucosidase II that cleaves sequentially the 2 innermost alpha-1,3-linked glucose residues from the Glc(2)Man(9)GlcNAc(2) oligosaccharide precursor of immature glycoproteins.
KEGG Pathway
Protein processing in endoplasmic reticulum (hsa04141 )
Reactome Pathway
Calnexin/calreticulin cycle (R-HSA-901042 )
N-glycan trimming in the ER and Calnexin/Calreticulin cycle (R-HSA-532668 )
Post-translational protein phosphorylation (R-HSA-8957275 )
Regulation of Insulin-like Growth Factor (IGF) transport and uptake by Insulin-like Growth Factor Binding Proteins (IGFBPs) (R-HSA-381426 )
Advanced glycosylation endproduct receptor signaling (R-HSA-879415 )

Molecular Interaction Atlas (MIA) of This DME

Molecular Interaction Atlas (MIA) Jump to Detail Molecular Interaction Atlas of This DME
1 Investigative Drug(s) Metabolized by This DME
Drug Name Drug ID Indication ICD 11 Highest Status REF
PNA-D-glucopyranoside DMPUC8I N. A. N. A. Investigative [1]

Molecular Expression Atlas (MEA) of This DME

Molecular Expression Atlas (MEA) Jump to Detail Molecular Expression Atlas of This DME
Disease Name ICD 11 Studied Tissue p-value Fold-Change Z-score
Acute myelocytic leukaemia 2B33.1 Bone marrow 1.31E-24 3.66E-01 9.06E-01
Alopecia ED70 Skin from scalp 2.50E-01 -3.49E-03 -8.90E-03
Alzheimer's disease 8A20 Entorhinal cortex 1.60E-01 4.51E-02 1.80E-01
Ankylosing spondylitis FA92.0 Pheripheral blood 2.48E-01 4.15E-02 2.25E-01
Aortic stenosis BB70 Calcified aortic valve 3.10E-01 1.05E-01 3.20E-01
Apnea 7A40 Hyperplastic tonsil 5.82E-01 -1.38E-01 -6.01E-01
Arthropathy FA00-FA5Z Peripheral blood 9.80E-02 -8.63E-02 -6.88E-01
Asthma CA23 Nasal and bronchial airway 3.56E-04 5.05E-01 6.07E-01
Atopic dermatitis EA80 Skin 2.90E-03 2.31E-01 6.95E-01
Autism 6A02 Whole blood 9.94E-01 3.91E-02 1.60E-01
Autoimmune uveitis 9A96 Peripheral monocyte 3.91E-02 3.31E-01 3.12E+00
Autosomal dominant monocytopenia 4B04 Whole blood 2.76E-01 -2.47E-01 -8.83E-01
Bacterial infection of gingival 1C1H Gingival tissue 8.82E-08 3.14E-01 7.47E-01
Batten disease 5C56.1 Whole blood 5.80E-01 9.28E-02 1.09E+00
Behcet's disease 4A62 Peripheral blood 6.68E-01 3.96E-02 1.42E-01
Bipolar disorder 6A60-6A6Z Prefrontal cortex 7.92E-01 4.36E-02 2.19E-01
Bladder cancer 2C94 Bladder tissue 2.36E-01 4.20E-01 1.09E+00
Breast cancer 2C60-2C6Z Breast tissue 1.98E-02 1.14E-01 1.30E-01
Cardioembolic stroke 8B11.20 Whole blood 9.42E-04 2.29E-01 1.47E+00
Cervical cancer 2C77 Cervical tissue 7.91E-04 2.11E-01 6.14E-01
Childhood onset rheumatic disease FA20.Z Peripheral blood 6.23E-01 -2.93E-03 -8.17E-03
Chronic hepatitis C 1E51.1 Whole blood 3.12E-01 -3.52E-02 -3.02E-01
Chronic obstructive pulmonary disease CA22 Lung tissue 1.37E-01 -2.94E-01 -6.12E-01
Chronic obstructive pulmonary disease CA22 Small airway epithelium 8.04E-01 -1.22E-02 -2.61E-02
Chronic rhinosinusitis CA0A Sinus mucosa tissue 3.64E-02 5.80E-01 1.71E+00
Colon cancer 2B90 Colon tissue 9.15E-11 -7.61E-02 -1.95E-01
Coronary artery disease BA80-BA8Z Peripheral blood 9.25E-01 -5.83E-03 -2.50E-02
Diffuse large B-cell lymphoma 2A81 Tonsil tissue 2.57E-01 -1.23E-01 -3.10E-01
Endometriosis GA10 Endometrium tissue 4.93E-02 -1.28E-01 -2.93E-01
Familial hypercholesterolemia 5C80.00 Peripheral blood 4.55E-01 -9.39E-02 -4.33E-01
Familial hypercholesterolemia 5C80.00 Whole blood 6.56E-07 3.95E-01 2.03E+00
Gastric cancer 2B72 Gastric tissue 5.16E-04 8.88E-02 1.03E+00
Glioblastopma 2A00.00 Nervous tissue 3.41E-16 -1.58E-01 -2.59E-01
Glioma 2A00.0Y-2A00.0Z Brain stem tissue 8.11E-01 -1.79E-01 -3.75E-01
Glioma 2A00.0Y-2A00.0Z White matter tissue 5.18E-04 5.30E-01 1.15E+00
Head and neck cancer 2D42 Head and neck tissue 5.87E-01 2.68E-02 5.88E-02
HIV-associated neurocognitive impairment 8A2Y-8A2Z White matter tissue 1.85E-01 1.19E-01 3.18E-01
Huntington's disease 8A01.10 Whole blood 4.10E-01 9.86E-02 4.37E-01
Idiopathic pulmonary fibrosis CB03.4 Lung tissue 1.34E-03 4.21E-01 4.83E+00
Immunodeficiency 4A00-4A20 Peripheral blood 9.68E-01 7.20E-02 2.74E-01
Influenza 1E30 Whole blood 5.10E-01 4.13E-01 1.10E+00
Interstitial cystitis GC00.3 Bladder tissue 7.40E-02 -2.02E-01 -4.79E-01
Intracranial aneurysm 8B01.0 Intracranial artery 2.68E-01 2.41E-01 3.57E-01
Irritable bowel syndrome DD91.0 Rectal colon tissue 2.92E-01 -2.39E-01 -5.65E-01
Ischemic stroke 8B11 Peripheral blood 5.76E-01 -5.51E-02 -2.47E-01
Juvenile idiopathic arthritis FA24 Peripheral blood 4.42E-04 -2.90E-01 -6.48E-01
Lateral sclerosis 8B60.4 Skin 5.96E-01 -1.49E-01 -4.05E-01
Lateral sclerosis 8B60.4 Cervical spinal cord 5.15E-01 3.02E-01 8.30E-01
Liver cancer 2C12.0 Liver tissue 8.10E-01 -3.51E-03 -5.60E-03
Liver failure DB99.7-DB99.8 Liver tissue 3.40E-03 5.40E-01 1.65E+00
Lung cancer 2C25 Lung tissue 3.27E-27 -3.45E-01 -8.95E-01
Lupus erythematosus 4A40 Whole blood 9.16E-01 9.20E-04 1.12E-03
Major depressive disorder 6A70-6A7Z Hippocampus 8.38E-01 5.98E-02 3.07E-01
Major depressive disorder 6A70-6A7Z Whole blood 8.95E-01 -5.16E-02 -1.06E-01
Melanoma 2C30 Skin 8.64E-02 1.48E-01 3.64E-01
Multiple myeloma 2A83.1 Peripheral blood 9.91E-01 -7.46E-02 -3.07E-01
Multiple myeloma 2A83.1 Bone marrow 6.18E-02 2.65E-01 8.62E-01
Multiple sclerosis 8A40 Plasmacytoid dendritic cells 8.77E-01 -9.25E-05 -3.39E-04
Myelodysplastic syndrome 2A36-2A3Z Bone marrow 5.38E-01 5.13E-02 1.21E-01
Myelofibrosis 2A20.2 Whole blood 8.77E-03 -2.95E-01 -2.05E+00
Myocardial infarction BA41-BA50 Peripheral blood 4.39E-01 -1.87E-01 -1.63E-01
Myopathy 8C70.6 Muscle tissue 9.26E-01 -2.69E-02 -1.17E-01
Neonatal sepsis KA60 Whole blood 7.25E-03 1.29E-01 2.20E-01
Neuroectodermal tumour 2A00.11 Brain stem tissue 5.11E-14 -1.99E+00 -9.01E+00
Non-alcoholic fatty liver disease DB92 Liver tissue 3.03E-01 -4.25E-01 -9.31E-01
Obesity related type 2 diabetes 5A11 Omental adipose tissue 7.44E-01 -3.92E-02 -2.67E-01
Olive pollen allergy CA08.00 Peripheral blood 2.40E-02 4.47E-01 1.49E+00
Oral cancer 2B6E Oral tissue 8.73E-01 1.71E-01 3.40E-01
Osteoarthritis FA00-FA0Z Synovial tissue 4.46E-01 6.20E-01 3.76E-01
Osteoporosis FB83.1 Bone marrow 4.33E-03 5.43E-01 2.40E+00
Ovarian cancer 2C73 Ovarian tissue 8.10E-02 -1.27E-03 -5.44E-03
Pancreatic cancer 2C10 Pancreas 6.95E-02 7.80E-01 1.13E+00
Parkinson's disease 8A00.0 Substantia nigra tissue 2.23E-01 -1.14E-01 -4.46E-01
Pediatric respiratory syncytial virus infection CA40.11 Peripheral blood 1.16E-01 -1.06E-01 -6.55E-01
Pituitary cancer 2D12 Pituitary tissue 5.47E-01 -1.59E-01 -5.47E-01
Pituitary gonadotrope tumour 2D12 Pituitary tissue 6.12E-02 -2.15E-01 -6.56E-01
Polycystic ovary syndrome 5A80.1 Vastus lateralis muscle 4.86E-01 1.63E-02 1.93E-01
Polycythemia vera 2A20.4 Whole blood 2.60E-16 -2.74E-01 -1.76E+00
Pompe disease 5C51.3 Biceps muscle 9.00E-01 -8.79E-03 -6.16E-02
Preterm birth KA21.4Z Myometrium 8.26E-01 -7.94E-03 -6.68E-02
Prostate cancer 2C82 Prostate 3.79E-01 3.58E-01 7.96E-01
Psoriasis EA90 Skin 5.02E-02 1.28E-02 2.79E-02
Rectal cancer 2B92 Rectal colon tissue 2.69E-01 1.54E-01 7.12E-01
Renal cancer 2C90-2C91 Kidney 3.40E-09 -1.32E-01 -9.07E-01
Retinoblastoma 2D02.2 Uvea 1.37E-04 -1.17E+00 -9.83E+00
Rheumatoid arthritis FA20 Synovial tissue 7.48E-13 1.70E+00 1.22E+01
Rhinovirus infection CA42.1 Nasal epithelium tissue 4.19E-02 -3.71E-02 -3.23E-01
Schizophrenia 6A20 Prefrontal cortex 6.61E-02 1.58E-01 4.00E-01
Schizophrenia 6A20 Superior temporal cortex 7.62E-02 -4.95E-02 -2.93E-01
Scleroderma 4A42.Z Whole blood 1.51E-10 -3.48E-01 -4.76E+00
Seizure 8A60-8A6Z Whole blood 5.99E-01 -5.50E-02 -1.55E-01
Sensitive skin EK0Z Skin 3.50E-01 8.30E-02 3.19E-01
Sepsis with septic shock 1G41 Whole blood 1.20E-04 -1.92E-01 -3.92E-01
Shwachman-Diamond syndrome 3A70.0 Bone marrow 1.06E-02 -3.94E-01 -1.89E+00
Sickle cell disease 3A51.0-3A51.3 Peripheral blood 1.60E-01 1.70E-01 4.91E-01
Simpson golabi behmel syndrome LD2C Adipose tissue 2.25E-01 2.54E-01 1.38E+00
Sjogren's syndrome 4A43.2 Salivary gland tissue 9.46E-03 8.54E-01 3.50E+00
Skin cancer 2C30-2C3Z Skin 2.71E-10 3.04E-01 6.53E-01
Thrombocythemia 3B63 Whole blood 8.40E-06 -3.36E-01 -2.24E+00
Thrombocytopenia 3B64 Whole blood 6.18E-01 3.49E-01 2.78E-01
Thyroid cancer 2D10 Thyroid 2.08E-01 -1.05E-01 -1.45E-01
Tibial muscular dystrophy 8C75 Muscle tissue 8.02E-03 4.94E-01 1.25E+00
Tuberous sclerosis complex LD2D.2 Perituberal tissue 4.66E-01 2.52E-01 8.91E-01
Type 2 diabetes 5A11 Liver tissue 3.75E-01 -1.64E-01 -5.72E-01
Ureter cancer 2C92 Urothelium 7.55E-01 8.54E-02 3.48E-01
Uterine cancer 2C78 Endometrium tissue 8.25E-11 -7.06E-01 -7.14E-01
Vitiligo ED63.0 Skin 2.99E-01 5.95E-02 5.58E-01
------------------------------------------------------------------------------------
⏷ Show the Full List of DME Expression Under 107 Diseases

References

1 The heterodimeric structure of glucosidase II is required for its activity, solubility, and localization in vivo. Glycobiology. 2000 Aug;10(8):815-27.