Details of Drug-Metabolizing Enzyme (DME)

General Information of Drug-Metabolizing Enzyme (DME) (ID: DE0EUXB)

DME Name Dihydropyrimidinase-related protein 1 (DRP1)
Synonyms Collapsin response mediator protein 1; Inactive dihydropyrimidinase; Unc-33-like phosphoprotein 3; CRMP-1; CRMP1; DPYSL1; DRP-1; ULIP-3; ULIP3
Gene Name CRMP1
UniProt ID
DPYL1_HUMAN
INTEDE ID
DME0442
3D Structure
Download
2D Sequence (FASTA)
Download
3D Structure (PDB)
Download
Gene ID
1400
EC Number EC: 3.5.2.2
Hydrolases
Carbon-nitrogen hydrolase
Cyclic amide hydrolase
EC: 3.5.2.2
Lineage Species: Homo sapiens
Kingdom: Metazoa
Phylum: Chordata
Class: Mammalia
Order: Primates
Family: Hominidae
Genus: Homo
Species: Homo sapiens
Sequence
MSYQGKKSIPHITSDRLLIKGGRIINDDQSLYADVYLEDGLIKQIGENLIVPGGVKTIEA
NGRMVIPGGIDVNTYLQKPSQGMTAADDFFQGTRAALVGGTTMIIDHVVPEPGSSLLTSF
EKWHEAADTKSCCDYSLHVDITSWYDGVREELEVLVQDKGVNSFQVYMAYKDVYQMSDSQ
LYEAFTFLKGLGAVILVHAENGDLIAQEQKRILEMGITGPEGHALSRPEELEAEAVFRAI
TIAGRINCPVYITKVMSKSAADIIALARKKGPLVFGEPIAASLGTDGTHYWSKNWAKAAA
FVTSPPLSPDPTTPDYLTSLLACGDLQVTGSGHCPYSTAQKAVGKDNFTLIPEGVNGIEE
RMTVVWDKAVATGKMDENQFVAVTSTNAAKIFNLYPRKGRIAVGSDADVVIWDPDKLKTI
TAKSHKSAVEYNIFEGMECHGSPLVVISQGKIVFEDGNINVNKGMGRFIPRKAFPEHLYQ
RVKIRNKVFGLQGVSRGMYDGPVYEVPATPKYATPAPSAKSSPSKHQPPPIRNLHQSNFS
LSGAQIDDNNPRRTGHRIVAPPGGRSNITSLG
Function This enzyme has hydrolase activity and hydrolase activity, acting on carbon-nitrogen (but not peptide) bonds, in cyclic amides.
Reactome Pathway
CRMPs in Sema3A signaling (R-HSA-399956 )

Molecular Interaction Atlas (MIA) of This DME

Molecular Interaction Atlas (MIA) Jump to Detail Molecular Interaction Atlas of This DME
1 Approved Drug(s) Metabolized by This DME
Drug Name Drug ID Indication ICD 11 Highest Status REF
Dexrazoxane DMD7X1O Breast cancer 2C60-2C65 Approved [1]

Molecular Expression Atlas (MEA) of This DME

Molecular Expression Atlas (MEA) Jump to Detail Molecular Expression Atlas of This DME
Disease Name ICD 11 Studied Tissue p-value Fold-Change Z-score
Acute myelocytic leukaemia 2B33.1 Bone marrow 1.49E-03 -9.48E-02 -3.31E-01
Alopecia ED70 Skin from scalp 4.33E-01 -1.76E-01 -4.46E-01
Alzheimer's disease 8A20 Entorhinal cortex 1.27E-10 -3.94E-01 -9.97E-01
Ankylosing spondylitis FA92.0 Pheripheral blood 4.18E-01 2.14E-02 2.25E-01
Aortic stenosis BB70 Calcified aortic valve 7.17E-01 1.01E-01 1.26E-01
Apnea 7A40 Hyperplastic tonsil 2.01E-02 -5.02E-01 -1.98E+00
Arthropathy FA00-FA5Z Peripheral blood 1.96E-01 4.71E-02 2.73E-01
Asthma CA23 Nasal and bronchial airway 4.41E-01 -1.61E-01 -2.54E-01
Atopic dermatitis EA80 Skin 6.78E-01 -1.62E-02 -9.60E-02
Autism 6A02 Whole blood 3.00E-01 4.39E-02 1.68E-01
Autoimmune uveitis 9A96 Peripheral monocyte 8.13E-02 -2.65E-01 -1.66E+00
Autosomal dominant monocytopenia 4B04 Whole blood 4.87E-01 -8.88E-02 -8.32E-01
Bacterial infection of gingival 1C1H Gingival tissue 3.76E-02 4.39E-02 1.33E-01
Batten disease 5C56.1 Whole blood 3.47E-01 8.91E-02 5.91E-01
Behcet's disease 4A62 Peripheral blood 2.67E-01 6.37E-02 3.25E-01
Bipolar disorder 6A60-6A6Z Prefrontal cortex 2.33E-01 -1.17E-01 -5.25E-01
Bladder cancer 2C94 Bladder tissue 5.01E-15 7.90E-01 8.46E+00
Breast cancer 2C60-2C6Z Breast tissue 3.24E-01 -1.02E-01 -2.52E-01
Cardioembolic stroke 8B11.20 Whole blood 7.83E-01 6.05E-02 2.98E-01
Cervical cancer 2C77 Cervical tissue 7.80E-01 -2.81E-02 -8.68E-02
Childhood onset rheumatic disease FA20.Z Peripheral blood 7.48E-01 -4.14E-02 -1.25E-01
Chronic hepatitis C 1E51.1 Whole blood 5.91E-01 1.97E-02 1.07E-01
Chronic obstructive pulmonary disease CA22 Lung tissue 9.95E-01 -6.21E-02 -1.57E-01
Chronic obstructive pulmonary disease CA22 Small airway epithelium 1.06E-01 1.08E-01 3.94E-01
Chronic rhinosinusitis CA0A Sinus mucosa tissue 8.93E-02 2.35E-01 1.87E+00
Colon cancer 2B90 Colon tissue 5.61E-03 -1.07E-01 -3.55E-01
Coronary artery disease BA80-BA8Z Peripheral blood 6.18E-01 -8.14E-03 -1.93E-02
Diffuse large B-cell lymphoma 2A81 Tonsil tissue 6.42E-01 4.45E-02 3.53E-01
Endometriosis GA10 Endometrium tissue 5.84E-01 -6.41E-01 -5.86E-01
Familial hypercholesterolemia 5C80.00 Peripheral blood 8.76E-01 -2.91E-02 -1.46E-01
Familial hypercholesterolemia 5C80.00 Whole blood 7.37E-03 -6.30E-02 -1.98E-01
Gastric cancer 2B72 Gastric tissue 6.97E-01 -2.72E-01 -7.85E-01
Glioblastopma 2A00.00 Nervous tissue 4.18E-15 -3.58E-01 -5.02E-01
Glioma 2A00.0Y-2A00.0Z Brain stem tissue 1.89E-01 7.91E-01 2.34E+00
Glioma 2A00.0Y-2A00.0Z White matter tissue 5.35E-09 3.65E+00 3.96E+00
Head and neck cancer 2D42 Head and neck tissue 5.02E-05 1.13E-01 3.50E-01
HIV-associated neurocognitive impairment 8A2Y-8A2Z White matter tissue 2.33E-01 -2.82E-01 -5.05E-01
Huntington's disease 8A01.10 Whole blood 9.17E-01 3.60E-02 1.09E-01
Idiopathic pulmonary fibrosis CB03.4 Lung tissue 2.21E-01 2.69E-01 6.19E-01
Immunodeficiency 4A00-4A20 Peripheral blood 5.09E-01 2.85E-02 2.56E-01
Influenza 1E30 Whole blood 5.64E-02 3.36E-01 1.70E+00
Interstitial cystitis GC00.3 Bladder tissue 2.02E-03 4.53E-01 2.89E+00
Intracranial aneurysm 8B01.0 Intracranial artery 1.24E-05 8.32E-01 2.97E+00
Irritable bowel syndrome DD91.0 Rectal colon tissue 2.78E-01 -2.96E-02 -1.27E-01
Ischemic stroke 8B11 Peripheral blood 1.77E-01 9.81E-03 4.92E-02
Juvenile idiopathic arthritis FA24 Peripheral blood 2.36E-02 5.51E-02 1.79E-01
Lateral sclerosis 8B60.4 Skin 6.75E-01 6.28E-02 4.71E-01
Lateral sclerosis 8B60.4 Cervical spinal cord 6.55E-01 -5.71E-02 -5.99E-02
Liver cancer 2C12.0 Liver tissue 2.42E-01 -1.18E-01 -4.19E-01
Liver failure DB99.7-DB99.8 Liver tissue 4.00E-01 4.34E-02 1.55E-01
Lung cancer 2C25 Lung tissue 2.89E-05 -3.85E-01 -1.02E+00
Lupus erythematosus 4A40 Whole blood 7.35E-03 -1.39E-01 -1.61E-01
Major depressive disorder 6A70-6A7Z Hippocampus 5.45E-01 2.96E-02 1.33E-01
Major depressive disorder 6A70-6A7Z Whole blood 2.38E-01 1.27E-02 5.28E-02
Melanoma 2C30 Skin 2.02E-01 8.13E-01 9.70E-01
Multiple myeloma 2A83.1 Peripheral blood 7.04E-01 9.78E-02 4.49E-01
Multiple myeloma 2A83.1 Bone marrow 2.62E-04 -5.03E-01 -1.95E+00
Multiple sclerosis 8A40 Plasmacytoid dendritic cells 9.06E-02 3.05E-01 6.86E-01
Myelodysplastic syndrome 2A36-2A3Z Bone marrow 9.14E-08 -6.23E-01 -1.13E+00
Myelofibrosis 2A20.2 Whole blood 1.60E-02 1.76E-01 1.05E+00
Myocardial infarction BA41-BA50 Peripheral blood 3.80E-02 4.13E-01 5.13E-01
Myopathy 8C70.6 Muscle tissue 2.59E-01 -1.18E-01 -6.94E-01
Neonatal sepsis KA60 Whole blood 2.42E-01 5.46E-02 1.62E-01
Neuroectodermal tumour 2A00.11 Brain stem tissue 1.26E-10 1.64E+00 5.48E+00
Non-alcoholic fatty liver disease DB92 Liver tissue 7.78E-01 2.24E-02 1.07E-01
Obesity related type 2 diabetes 5A11 Omental adipose tissue 5.90E-02 1.83E-01 1.21E+00
Olive pollen allergy CA08.00 Peripheral blood 1.07E-01 2.46E-01 1.19E+00
Oral cancer 2B6E Oral tissue 3.30E-02 -3.39E-01 -7.33E-01
Osteoarthritis FA00-FA0Z Synovial tissue 1.38E-01 -2.17E-01 -5.06E-01
Osteoporosis FB83.1 Bone marrow 3.28E-01 1.83E-01 1.73E+00
Ovarian cancer 2C73 Ovarian tissue 4.68E-01 -3.86E-01 -1.08E+00
Pancreatic cancer 2C10 Pancreas 6.26E-01 -1.69E-01 -3.73E-01
Parkinson's disease 8A00.0 Substantia nigra tissue 2.16E-01 -1.60E-01 -3.15E-01
Pediatric respiratory syncytial virus infection CA40.11 Peripheral blood 8.96E-01 1.60E-03 8.50E-03
Pituitary cancer 2D12 Pituitary tissue 8.87E-02 1.84E-01 1.04E+00
Pituitary gonadotrope tumour 2D12 Pituitary tissue 6.36E-01 1.40E-01 7.25E-01
Polycystic ovary syndrome 5A80.1 Vastus lateralis muscle 1.65E-01 -6.25E-02 -7.36E-01
Polycythemia vera 2A20.4 Whole blood 3.34E-13 2.62E-01 1.60E+00
Pompe disease 5C51.3 Biceps muscle 2.16E-01 2.00E-01 7.83E-01
Preterm birth KA21.4Z Myometrium 2.98E-02 -3.94E-01 -9.74E-01
Prostate cancer 2C82 Prostate 5.22E-05 -6.21E-01 -1.21E+00
Psoriasis EA90 Skin 3.75E-20 -3.36E-01 -8.92E-01
Rectal cancer 2B92 Rectal colon tissue 4.62E-02 9.07E-02 5.28E-01
Renal cancer 2C90-2C91 Kidney 3.64E-02 -1.54E-01 -3.51E-01
Retinoblastoma 2D02.2 Uvea 2.03E-09 -4.04E+00 -1.17E+01
Rheumatoid arthritis FA20 Synovial tissue 2.50E-01 2.73E-02 8.88E-02
Rhinovirus infection CA42.1 Nasal epithelium tissue 3.16E-01 -8.33E-02 -6.66E-01
Schizophrenia 6A20 Prefrontal cortex 6.94E-02 -2.22E-01 -1.38E-01
Schizophrenia 6A20 Superior temporal cortex 6.55E-01 7.08E-02 3.36E-01
Scleroderma 4A42.Z Whole blood 3.78E-01 -5.00E-02 -2.87E-01
Seizure 8A60-8A6Z Whole blood 3.56E-01 2.54E-02 9.46E-02
Sensitive skin EK0Z Skin 6.34E-01 7.32E-02 8.75E-01
Sepsis with septic shock 1G41 Whole blood 1.93E-04 1.29E-01 3.97E-01
Shwachman-Diamond syndrome 3A70.0 Bone marrow 1.54E-01 5.72E-02 1.78E-01
Sickle cell disease 3A51.0-3A51.3 Peripheral blood 1.25E-01 3.39E-01 8.87E-01
Simpson golabi behmel syndrome LD2C Adipose tissue 8.41E-01 -3.51E-02 -2.42E-01
Sjogren's syndrome 4A43.2 Salivary gland tissue 5.08E-03 7.66E-01 4.28E+00
Skin cancer 2C30-2C3Z Skin 9.46E-02 -3.51E-01 -5.90E-01
Thrombocythemia 3B63 Whole blood 6.49E-03 2.60E-01 1.42E+00
Thrombocytopenia 3B64 Whole blood 5.40E-01 5.44E-02 3.51E-01
Thyroid cancer 2D10 Thyroid 1.91E-26 3.93E-01 1.74E+00
Tibial muscular dystrophy 8C75 Muscle tissue 4.38E-01 6.16E-02 2.61E-01
Tuberous sclerosis complex LD2D.2 Perituberal tissue 2.02E-01 -3.09E-01 -1.39E+00
Type 2 diabetes 5A11 Liver tissue 3.28E-01 9.55E-02 7.82E-01
Ureter cancer 2C92 Urothelium 9.63E-01 -5.09E-03 -2.19E-02
Uterine cancer 2C78 Endometrium tissue 5.90E-29 -1.02E+00 -1.70E+00
Vitiligo ED63.0 Skin 5.73E-01 2.61E-02 8.82E-02
------------------------------------------------------------------------------------
⏷ Show the Full List of DME Expression Under 107 Diseases

References

1 Metabolism of the cardioprotective drug dexrazoxane and one of its metabolites by isolated rat myocytes, hepatocytes, and blood. Drug Metab Dispos. 2005 Jun;33(6):719-25.