Details of Drug-Metabolizing Enzyme (DME)

General Information of Drug-Metabolizing Enzyme (DME) (ID: DE14JZK)

DME Name Cathepsin A (CTSA)
Synonyms
Carboxypeptidase C; Carboxypeptidase L; Lysosomal protective protein; Lysosomal protective protein 20 kDa chain; Lysosomal protective protein 32 kDa chain; CTSA; PPCA; PPGB; Protective protein cathepsin A; Protective protein for beta-galactosidase
Gene Name CTSA
UniProt ID
PPGB_HUMAN
INTEDE ID
DME0071
3D Structure
Download
2D Sequence (FASTA)
Download
3D Structure (PDB)
Download
Gene ID
5476
EC Number EC: 3.4.16.5
Hydrolases
Peptidase
Serine carboxypeptidase
EC: 3.4.16.5
Lineage Species: Homo sapiens
Kingdom: Metazoa
Phylum: Chordata
Class: Mammalia
Order: Primates
Family: Hominidae
Genus: Homo
Species: Homo sapiens
Sequence
MIRAAPPPLFLLLLLLLLLVSWASRGEAAPDQDEIQRLPGLAKQPSFRQYSGYLKGSGSK
HLHYWFVESQKDPENSPVVLWLNGGPGCSSLDGLLTEHGPFLVQPDGVTLEYNPYSWNLI
ANVLYLESPAGVGFSYSDDKFYATNDTEVAQSNFEALQDFFRLFPEYKNNKLFLTGESYA
GIYIPTLAVLVMQDPSMNLQGLAVGNGLSSYEQNDNSLVYFAYYHGLLGNRLWSSLQTHC
CSQNKCNFYDNKDLECVTNLQEVARIVGNSGLNIYNLYAPCAGGVPSHFRYEKDTVVVQD
LGNIFTRLPLKRMWHQALLRSGDKVRMDPPCTNTTAASTYLNNPYVRKALNIPEQLPQWD
MCNFLVNLQYRRLYRSMNSQYLKLLSSQKYQILLYNGDVDMACNFMGDEWFVDSLNQKME
VQRRPWLVKYGDSGEQIAGFVKEFSHIAFLTIKGAGHMVPTDKPLAAFTMFSRFLNKQPY
Function This enzyme is a carboxypeptidase and can deamidate tachykinins.
KEGG Pathway
Lysosome (hsa04142 )
Renin-angiotensin system (hsa04614 )
Reactome Pathway
Glycosphingolipid metabolism (R-HSA-1660662 )
MHC class II antigen presentation (R-HSA-2132295 )
Neutrophil degranulation (R-HSA-6798695 )
Sialic acid metabolism (R-HSA-4085001 )
Defective NEU1 causes sialidosis (R-HSA-4341670 )

Molecular Interaction Atlas (MIA) of This DME

Molecular Interaction Atlas (MIA) Jump to Detail Molecular Interaction Atlas of This DME
1 Approved Drug(s) Metabolized by This DME
Drug Name Drug ID Indication ICD 11 Highest Status REF
Tenofovir alafenamide DMTQF4A Hiv infectious disease Approved [4]

Molecular Expression Atlas (MEA) of This DME

Molecular Expression Atlas (MEA) Jump to Detail Molecular Expression Atlas of This DME
Disease Name ICD 11 Studied Tissue p-value Fold-Change Z-score
Acute myelocytic leukaemia 2B33.1 Bone marrow 4.74E-23 8.20E-01 1.35E+00
Alopecia ED70 Skin from scalp 2.15E-01 1.02E-01 4.14E-01
Alzheimer's disease 8A20 Entorhinal cortex 1.87E-01 -2.96E-02 -1.36E-01
Ankylosing spondylitis FA92.0 Pheripheral blood 6.22E-01 2.10E-01 5.05E-01
Aortic stenosis BB70 Calcified aortic valve 6.68E-01 1.14E-02 1.91E-02
Apnea 7A40 Hyperplastic tonsil 2.28E-01 -3.97E-01 -1.20E+00
Arthropathy FA00-FA5Z Peripheral blood 1.73E-02 2.13E-01 8.86E-01
Asthma CA23 Nasal and bronchial airway 2.83E-04 1.42E-01 1.24E-01
Atopic dermatitis EA80 Skin 8.40E-01 -2.56E-02 -1.72E-01
Autism 6A02 Whole blood 2.27E-02 2.86E-01 5.60E-01
Autoimmune uveitis 9A96 Peripheral monocyte 5.51E-01 1.50E-01 2.96E-01
Autosomal dominant monocytopenia 4B04 Whole blood 1.88E-03 1.14E+00 3.34E+00
Bacterial infection of gingival 1C1H Gingival tissue 2.86E-04 2.32E-01 6.85E-01
Batten disease 5C56.1 Whole blood 9.55E-01 -3.96E-03 -6.76E-03
Behcet's disease 4A62 Peripheral blood 4.57E-01 4.65E-02 1.38E-01
Bipolar disorder 6A60-6A6Z Prefrontal cortex 1.96E-01 -9.81E-03 -7.61E-02
Bladder cancer 2C94 Bladder tissue 4.63E-04 3.37E-01 1.77E+00
Breast cancer 2C60-2C6Z Breast tissue 5.59E-57 7.31E-01 1.36E+00
Cardioembolic stroke 8B11.20 Whole blood 5.62E-01 6.02E-02 2.45E-01
Cervical cancer 2C77 Cervical tissue 9.39E-01 9.48E-02 1.89E-01
Childhood onset rheumatic disease FA20.Z Peripheral blood 4.37E-02 2.10E-01 4.71E-01
Chronic hepatitis C 1E51.1 Whole blood 8.96E-01 -2.67E-01 -5.55E-01
Chronic obstructive pulmonary disease CA22 Lung tissue 2.98E-01 -1.42E-01 -3.95E-01
Chronic obstructive pulmonary disease CA22 Small airway epithelium 4.95E-01 1.29E-01 4.11E-01
Chronic rhinosinusitis CA0A Sinus mucosa tissue 7.90E-02 1.10E-01 4.38E-01
Colon cancer 2B90 Colon tissue 2.52E-49 -7.61E-01 -1.81E+00
Coronary artery disease BA80-BA8Z Peripheral blood 8.53E-02 1.81E-01 4.21E-01
Diffuse large B-cell lymphoma 2A81 Tonsil tissue 5.89E-02 -1.80E-01 -4.69E-01
Endometriosis GA10 Endometrium tissue 4.82E-01 4.88E-01 6.52E-01
Familial hypercholesterolemia 5C80.00 Peripheral blood 9.34E-01 7.44E-03 3.36E-02
Familial hypercholesterolemia 5C80.00 Whole blood 8.46E-09 1.76E+00 2.03E+00
Gastric cancer 2B72 Gastric tissue 4.37E-02 7.62E-01 2.16E+00
Glioblastopma 2A00.00 Nervous tissue 8.27E-03 4.61E-03 1.20E-02
Glioma 2A00.0Y-2A00.0Z Brain stem tissue 2.78E-01 -3.96E-01 -1.53E+00
Glioma 2A00.0Y-2A00.0Z White matter tissue 1.13E-02 1.79E+00 1.34E+00
Head and neck cancer 2D42 Head and neck tissue 2.78E-22 4.68E-01 1.69E+00
HIV-associated neurocognitive impairment 8A2Y-8A2Z White matter tissue 9.77E-02 1.56E-01 5.70E-01
Huntington's disease 8A01.10 Whole blood 1.04E-01 2.95E-01 1.00E+00
Idiopathic pulmonary fibrosis CB03.4 Lung tissue 4.57E-02 4.02E-01 1.65E+00
Immunodeficiency 4A00-4A20 Peripheral blood 9.01E-02 -1.17E-01 -8.16E-01
Influenza 1E30 Whole blood 4.14E-01 -2.23E-01 -6.90E-01
Interstitial cystitis GC00.3 Bladder tissue 1.52E-02 7.24E-01 2.17E+00
Intracranial aneurysm 8B01.0 Intracranial artery 8.99E-04 1.01E+00 2.24E+00
Irritable bowel syndrome DD91.0 Rectal colon tissue 6.43E-02 -4.14E-01 -6.24E-01
Ischemic stroke 8B11 Peripheral blood 6.63E-01 1.61E-02 4.65E-02
Juvenile idiopathic arthritis FA24 Peripheral blood 6.82E-03 -3.74E-01 -5.79E-01
Lateral sclerosis 8B60.4 Skin 5.48E-01 -6.59E-02 -4.34E-01
Lateral sclerosis 8B60.4 Cervical spinal cord 9.04E-01 2.18E-01 3.31E-01
Liver cancer 2C12.0 Liver tissue 2.01E-20 1.07E+00 2.39E+00
Liver failure DB99.7-DB99.8 Liver tissue 5.01E-03 5.90E-01 1.29E+00
Lung cancer 2C25 Lung tissue 6.83E-08 1.99E-01 5.86E-01
Lupus erythematosus 4A40 Whole blood 9.27E-11 3.69E-01 6.05E-01
Major depressive disorder 6A70-6A7Z Hippocampus 3.73E-01 -2.73E-02 -2.04E-01
Major depressive disorder 6A70-6A7Z Whole blood 1.17E-01 1.64E-01 3.26E-01
Melanoma 2C30 Skin 3.61E-03 5.25E-01 7.49E-01
Multiple myeloma 2A83.1 Peripheral blood 3.44E-01 2.62E-02 7.68E-02
Multiple myeloma 2A83.1 Bone marrow 2.05E-02 3.79E-01 1.23E+00
Multiple sclerosis 8A40 Plasmacytoid dendritic cells 6.99E-01 1.43E-01 3.20E-01
Myelodysplastic syndrome 2A36-2A3Z Bone marrow 1.11E-03 4.86E-01 8.76E-01
Myelofibrosis 2A20.2 Whole blood 6.74E-01 1.08E-01 3.23E-01
Myocardial infarction BA41-BA50 Peripheral blood 8.00E-01 1.92E-01 2.48E-01
Myopathy 8C70.6 Muscle tissue 4.01E-08 5.91E-01 6.39E+00
Neonatal sepsis KA60 Whole blood 4.84E-36 1.44E+00 2.57E+00
Neuroectodermal tumour 2A00.11 Brain stem tissue 3.83E-01 -1.60E-01 -6.37E-01
Non-alcoholic fatty liver disease DB92 Liver tissue 4.03E-01 -1.90E-01 -4.93E-01
Obesity related type 2 diabetes 5A11 Omental adipose tissue 1.03E-03 5.58E-01 2.92E+00
Olive pollen allergy CA08.00 Peripheral blood 3.58E-01 1.12E-01 4.45E-01
Oral cancer 2B6E Oral tissue 4.66E-03 3.72E-01 6.79E-01
Osteoarthritis FA00-FA0Z Synovial tissue 2.16E-01 7.80E-01 4.71E-01
Osteoporosis FB83.1 Bone marrow 6.09E-01 5.66E-02 2.79E-01
Ovarian cancer 2C73 Ovarian tissue 9.96E-04 4.90E-01 1.82E+00
Pancreatic cancer 2C10 Pancreas 3.26E-05 8.53E-01 1.09E+00
Parkinson's disease 8A00.0 Substantia nigra tissue 9.80E-01 2.26E-02 7.88E-02
Pediatric respiratory syncytial virus infection CA40.11 Peripheral blood 1.22E-04 6.90E-01 1.31E+00
Pituitary cancer 2D12 Pituitary tissue 9.17E-01 6.75E-02 1.77E-01
Pituitary gonadotrope tumour 2D12 Pituitary tissue 8.35E-01 -1.50E-02 -3.91E-02
Polycystic ovary syndrome 5A80.1 Vastus lateralis muscle 7.67E-02 -9.09E-02 -4.27E-01
Polycythemia vera 2A20.4 Whole blood 9.07E-01 3.96E-02 1.11E-01
Pompe disease 5C51.3 Biceps muscle 3.04E-05 1.29E+00 6.35E+00
Preterm birth KA21.4Z Myometrium 6.11E-01 -1.29E-01 -4.54E-01
Prostate cancer 2C82 Prostate 5.34E-08 -6.63E-01 -1.63E+00
Psoriasis EA90 Skin 4.16E-06 1.41E-01 5.09E-01
Rectal cancer 2B92 Rectal colon tissue 2.17E-02 -1.87E-01 -9.43E-01
Renal cancer 2C90-2C91 Kidney 1.83E-01 -4.48E-01 -5.26E-01
Retinoblastoma 2D02.2 Uvea 1.77E-05 8.71E-01 4.45E+00
Rheumatoid arthritis FA20 Synovial tissue 7.95E-07 2.19E+00 4.28E+00
Rhinovirus infection CA42.1 Nasal epithelium tissue 5.14E-01 -5.64E-02 -2.44E-01
Schizophrenia 6A20 Prefrontal cortex 7.14E-02 1.63E-01 2.48E-01
Schizophrenia 6A20 Superior temporal cortex 5.02E-01 -5.87E-02 -3.39E-01
Scleroderma 4A42.Z Whole blood 5.61E-01 -6.00E-02 -2.14E-01
Seizure 8A60-8A6Z Whole blood 1.19E-02 -5.21E-01 -1.10E+00
Sensitive skin EK0Z Skin 3.49E-01 1.08E-01 4.12E-01
Sepsis with septic shock 1G41 Whole blood 2.94E-70 1.29E+00 2.50E+00
Shwachman-Diamond syndrome 3A70.0 Bone marrow 1.52E-01 -3.05E-01 -1.28E+00
Sickle cell disease 3A51.0-3A51.3 Peripheral blood 4.62E-03 5.35E-01 1.08E+00
Simpson golabi behmel syndrome LD2C Adipose tissue 9.32E-01 1.17E-01 2.32E-01
Sjogren's syndrome 4A43.2 Salivary gland tissue 3.94E-01 -2.97E-02 -1.19E-01
Skin cancer 2C30-2C3Z Skin 4.59E-02 2.00E-01 5.86E-01
Thrombocythemia 3B63 Whole blood 6.82E-01 1.20E-01 3.54E-01
Thrombocytopenia 3B64 Whole blood 5.07E-01 2.30E-01 1.71E-01
Thyroid cancer 2D10 Thyroid 1.58E-44 8.31E-01 2.50E+00
Tibial muscular dystrophy 8C75 Muscle tissue 3.07E-06 5.61E-01 1.65E+00
Tuberous sclerosis complex LD2D.2 Perituberal tissue 6.41E-01 4.57E-03 3.33E-02
Type 2 diabetes 5A11 Liver tissue 4.90E-01 1.48E-02 6.58E-02
Ureter cancer 2C92 Urothelium 8.52E-01 -6.17E-02 -2.10E-01
Uterine cancer 2C78 Endometrium tissue 1.70E-12 -4.02E-01 -5.42E-01
Vitiligo ED63.0 Skin 8.11E-02 -4.41E-02 -3.98E-01
------------------------------------------------------------------------------------
⏷ Show the Full List of DME Expression Under 107 Diseases

The Drug Therapeutic Target (DTT) Role of This DME

DME DTT Name Cathepsin A (CTSA) DTT Info
DME DTT Type Clinical trial
1 Clinical Trial Drug(s) Targeting This DTT
Drug Name Drug ID Indication ICD 11 Highest Status REF
SAR164653 DMQ98MW Diabetic complication 5A2Y Phase 1 [1]
2 Investigative Drug(s) Targeting This DTT
Drug Name Drug ID Indication ICD 11 Highest Status REF
example 166 (WO2014154727) DMY3CKG Discovery agent N.A. Investigative [2]
PMID22861813C8a DM6RY4F Discovery agent N.A. Investigative [3]

References

1 Tolerability, safety and pharmacokinetics of the novel Cathepsin A inhibitor SAR164653 in healthy subjects.Clinical Pharmacology in Drug Development 05/2015.
2 URL: http://www.guidetopharmacology.org Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Target id: 1581).
3 Novel beta-amino acid derivatives as inhibitors of cathepsin A. J Med Chem. 2012 Sep 13;55(17):7636-49.
4 Bictegravir/Emtricitabine/Tenofovir Alafenamide: a review in HIV-1 infection. Drugs. 2018 Nov;78(17):1817-1828.