Details of Drug-Metabolizing Enzyme (DME)

General Information of Drug-Metabolizing Enzyme (DME) (ID: DE1VDSF)

DME Name MOSC domain-containing protein 1 (MARC1)
Synonyms Moco sulfurase C-terminal domain-containing protein 1; Molybdenum cofactor sulfurase C-terminal domain-containing protein 1; Mitochondrial amidoxime-reducing component 1; MARC1; MOSC1; MTARC1
Gene Name MTARC1
UniProt ID
MARC1_HUMAN
INTEDE ID
DME0540
3D Structure
Download
2D Sequence (FASTA)
Download
3D Structure (PDB)
Download
Gene ID
64757
EC Number EC: 1.7.2.1
Oxidoreductase
Cytochrome acceptor oxidoreductase
Cytochrome acceptor oxidoreductase
EC: 1.7.2.1
Lineage Species: Homo sapiens
Kingdom: Metazoa
Phylum: Chordata
Class: Mammalia
Order: Primates
Family: Hominidae
Genus: Homo
Species: Homo sapiens
Sequence
MGAAGSSALARFVLLAQSRPGWLGVAALGLTAVALGAVAWRRAWPTRRRRLLQQVGTVAQ
LWIYPVKSCKGVPVSEAECTAMGLRSGNLRDRFWLVINQEGNMVTARQEPRLVLISLTCD
GDTLTLSAAYTKDLLLPIKTPTTNAVHKCRVHGLEIEGRDCGEATAQWITSFLKSQPYRL
VHFEPHMRPRRPHQIADLFRPKDQIAYSDTSPFLILSEASLADLNSRLEKKVKATNFRPN
IVISGCDVYAEDSWDELLIGDVELKRVMACSRCILTTVDPDTGVMSRKEPLETLKSYRQC
DPSERKLYGKSPLFGQYFVLENPGTIKVGDPVYLLGQ
Function
This enzyme catalyzes the reduction of N-oxygenated molecules, acting as a counterpart of cytochrome P450 and flavin-containing monooxygenases in metabolic cycles. As a component of prodrug-converting system, it reduces a multitude of N-hydroxylated prodrugs particularly amidoximes, leading to increased drug bioavailability.
Reactome Pathway
Phase I - Functionalization of compounds (R-HSA-211945 )

Molecular Interaction Atlas (MIA) of This DME

Molecular Interaction Atlas (MIA) Jump to Detail Molecular Interaction Atlas of This DME
1 Investigative Drug(s) Metabolized by This DME
Drug Name Drug ID Indication ICD 11 Highest Status REF
Nitrite DMR5XT3 N. A. N. A. Investigative [1]

Molecular Expression Atlas (MEA) of This DME

Molecular Expression Atlas (MEA) Jump to Detail Molecular Expression Atlas of This DME
Disease Name ICD 11 Studied Tissue p-value Fold-Change Z-score
Acute myelocytic leukaemia 2B33.1 Bone marrow 2.88E-27 -1.03E+00 -1.66E+00
Alopecia ED70 Skin from scalp 5.43E-03 5.48E-01 8.11E-01
Alzheimer's disease 8A20 Entorhinal cortex 1.57E-02 -6.00E-02 -2.95E-01
Ankylosing spondylitis FA92.0 Pheripheral blood 6.45E-01 1.03E-01 3.14E-01
Aortic stenosis BB70 Calcified aortic valve 2.14E-03 -4.34E-01 -1.16E+00
Apnea 7A40 Hyperplastic tonsil 4.76E-02 3.13E-01 9.99E-01
Arthropathy FA00-FA5Z Peripheral blood 5.03E-01 5.10E-02 1.09E-01
Asthma CA23 Nasal and bronchial airway 2.58E-03 1.24E-01 1.18E-01
Atopic dermatitis EA80 Skin 7.43E-02 -7.92E-03 -1.33E-02
Autism 6A02 Whole blood 8.34E-01 8.71E-02 2.30E-01
Autoimmune uveitis 9A96 Peripheral monocyte 9.74E-01 -4.26E-01 -5.41E-01
Autosomal dominant monocytopenia 4B04 Whole blood 5.76E-03 -1.02E+00 -1.40E+00
Bacterial infection of gingival 1C1H Gingival tissue 3.20E-01 9.27E-02 2.23E-01
Batten disease 5C56.1 Whole blood 9.28E-01 -7.71E-03 -1.47E-02
Behcet's disease 4A62 Peripheral blood 4.13E-01 1.62E-01 4.16E-01
Bipolar disorder 6A60-6A6Z Prefrontal cortex 9.04E-01 -6.78E-02 -3.55E-01
Bladder cancer 2C94 Bladder tissue 9.30E-01 1.66E-02 6.88E-02
Breast cancer 2C60-2C6Z Breast tissue 1.72E-56 -1.61E+00 -1.25E+00
Cardioembolic stroke 8B11.20 Whole blood 2.67E-08 1.24E+00 1.87E+00
Cervical cancer 2C77 Cervical tissue 9.82E-02 2.43E-01 6.24E-01
Childhood onset rheumatic disease FA20.Z Peripheral blood 6.04E-01 4.07E-01 3.83E-01
Chronic hepatitis C 1E51.1 Whole blood 6.92E-01 1.24E-02 2.11E-02
Chronic obstructive pulmonary disease CA22 Lung tissue 5.36E-01 -3.26E-02 -1.30E-01
Chronic obstructive pulmonary disease CA22 Small airway epithelium 9.09E-06 -1.71E-01 -5.94E-01
Chronic rhinosinusitis CA0A Sinus mucosa tissue 1.62E-01 -1.09E-01 -4.05E-01
Colon cancer 2B90 Colon tissue 9.63E-07 -1.61E-01 -3.53E-01
Coronary artery disease BA80-BA8Z Peripheral blood 8.90E-01 -3.23E-02 -4.41E-02
Diffuse large B-cell lymphoma 2A81 Tonsil tissue 6.45E-01 1.37E-01 2.73E-01
Endometriosis GA10 Endometrium tissue 1.76E-01 9.87E-02 1.18E-01
Familial hypercholesterolemia 5C80.00 Peripheral blood 1.29E-01 -8.69E-02 -2.37E-01
Familial hypercholesterolemia 5C80.00 Whole blood 2.97E-04 5.88E-01 1.61E+00
Gastric cancer 2B72 Gastric tissue 7.29E-01 -3.93E-02 -8.43E-02
Glioblastopma 2A00.00 Nervous tissue 1.95E-31 2.43E-01 8.72E-01
Glioma 2A00.0Y-2A00.0Z Brain stem tissue 3.90E-01 3.77E-01 8.35E-01
Glioma 2A00.0Y-2A00.0Z White matter tissue 4.45E-01 3.73E-01 4.26E-01
Head and neck cancer 2D42 Head and neck tissue 7.08E-26 -7.97E-01 -2.07E+00
HIV-associated neurocognitive impairment 8A2Y-8A2Z White matter tissue 5.69E-02 -1.66E-01 -6.77E-01
Huntington's disease 8A01.10 Whole blood 7.25E-01 -3.05E-01 -3.19E-01
Idiopathic pulmonary fibrosis CB03.4 Lung tissue 1.68E-05 -7.88E-01 -4.22E+00
Immunodeficiency 4A00-4A20 Peripheral blood 4.48E-01 3.22E-02 2.76E-01
Influenza 1E30 Whole blood 8.52E-01 -9.41E-03 -6.44E-02
Interstitial cystitis GC00.3 Bladder tissue 2.74E-04 -9.35E-01 -3.30E+00
Intracranial aneurysm 8B01.0 Intracranial artery 5.63E-08 -1.28E+00 -5.44E+00
Irritable bowel syndrome DD91.0 Rectal colon tissue 8.14E-01 7.45E-02 1.90E-01
Ischemic stroke 8B11 Peripheral blood 7.70E-01 -1.81E-02 -4.25E-02
Juvenile idiopathic arthritis FA24 Peripheral blood 1.19E-01 4.52E-02 5.85E-02
Lateral sclerosis 8B60.4 Skin 3.80E-01 2.00E-01 8.24E-01
Lateral sclerosis 8B60.4 Cervical spinal cord 2.78E-01 -2.23E-01 -7.15E-01
Liver cancer 2C12.0 Liver tissue 1.99E-04 -6.20E-01 -8.91E-01
Liver failure DB99.7-DB99.8 Liver tissue 2.90E-05 -1.62E+00 -2.85E+00
Lung cancer 2C25 Lung tissue 1.25E-01 -1.83E-01 -5.36E-01
Lupus erythematosus 4A40 Whole blood 7.07E-12 5.88E-01 5.73E-01
Major depressive disorder 6A70-6A7Z Hippocampus 7.60E-01 -2.74E-02 -1.34E-01
Major depressive disorder 6A70-6A7Z Whole blood 1.31E-05 3.35E-01 8.13E-01
Melanoma 2C30 Skin 4.99E-03 -6.51E-01 -6.06E-01
Multiple myeloma 2A83.1 Peripheral blood 2.60E-02 2.18E-01 1.06E+00
Multiple myeloma 2A83.1 Bone marrow 1.67E-01 -6.16E-02 -1.82E-01
Multiple sclerosis 8A40 Plasmacytoid dendritic cells 4.11E-02 1.91E-01 1.40E+00
Myelodysplastic syndrome 2A36-2A3Z Bone marrow 8.20E-01 -3.17E-02 -5.64E-02
Myelofibrosis 2A20.2 Whole blood 4.51E-01 -7.53E-02 -2.71E-01
Myocardial infarction BA41-BA50 Peripheral blood 8.41E-04 2.17E+00 1.23E+00
Myopathy 8C70.6 Muscle tissue 9.35E-01 1.54E-01 5.17E-01
Neonatal sepsis KA60 Whole blood 1.00E-30 1.49E+00 2.09E+00
Neuroectodermal tumour 2A00.11 Brain stem tissue 7.81E-01 4.98E-02 2.07E-01
Non-alcoholic fatty liver disease DB92 Liver tissue 4.13E-01 7.95E-02 2.59E-01
Obesity related type 2 diabetes 5A11 Omental adipose tissue 3.28E-02 4.01E-01 9.77E-01
Olive pollen allergy CA08.00 Peripheral blood 1.19E-01 1.59E-01 8.71E-01
Oral cancer 2B6E Oral tissue 7.55E-05 -4.67E-01 -8.25E-01
Osteoarthritis FA00-FA0Z Synovial tissue 1.75E-02 -8.77E-01 -1.22E+00
Osteoporosis FB83.1 Bone marrow 1.22E-01 1.32E-01 6.59E-01
Ovarian cancer 2C73 Ovarian tissue 1.18E-05 6.04E-01 2.54E+00
Pancreatic cancer 2C10 Pancreas 2.80E-01 -1.76E-01 -2.55E-01
Parkinson's disease 8A00.0 Substantia nigra tissue 8.04E-01 -4.14E-02 -1.31E-01
Pediatric respiratory syncytial virus infection CA40.11 Peripheral blood 1.37E-06 1.10E+00 3.01E+00
Pituitary cancer 2D12 Pituitary tissue 5.19E-03 5.68E-01 1.24E+00
Pituitary gonadotrope tumour 2D12 Pituitary tissue 1.25E-03 4.52E-01 1.39E+00
Polycystic ovary syndrome 5A80.1 Vastus lateralis muscle 9.31E-01 5.07E-02 2.70E-01
Polycythemia vera 2A20.4 Whole blood 7.11E-07 2.75E-01 1.08E+00
Pompe disease 5C51.3 Biceps muscle 1.02E-01 -1.02E-01 -1.52E-01
Preterm birth KA21.4Z Myometrium 5.08E-01 1.66E-01 5.27E-01
Prostate cancer 2C82 Prostate 1.41E-02 4.60E-01 4.41E-01
Psoriasis EA90 Skin 7.91E-20 -7.34E-01 -1.19E+00
Rectal cancer 2B92 Rectal colon tissue 4.42E-01 4.03E-02 2.09E-01
Renal cancer 2C90-2C91 Kidney 2.33E-02 -6.96E-02 -3.56E-01
Retinoblastoma 2D02.2 Uvea 5.33E-01 -7.35E-02 -5.05E-01
Rheumatoid arthritis FA20 Synovial tissue 1.20E-03 -9.02E-01 -1.66E+00
Rhinovirus infection CA42.1 Nasal epithelium tissue 6.81E-01 2.19E-02 1.46E-01
Schizophrenia 6A20 Prefrontal cortex 4.61E-02 2.10E-01 4.06E-01
Schizophrenia 6A20 Superior temporal cortex 6.97E-01 -1.29E-03 -1.10E-02
Scleroderma 4A42.Z Whole blood 8.76E-02 4.97E-01 1.23E+00
Seizure 8A60-8A6Z Whole blood 1.71E-01 5.41E-01 1.15E+00
Sensitive skin EK0Z Skin 6.13E-01 2.26E-01 7.56E-01
Sepsis with septic shock 1G41 Whole blood 4.58E-63 1.43E+00 2.20E+00
Shwachman-Diamond syndrome 3A70.0 Bone marrow 1.62E-01 -2.30E-01 -8.65E-01
Sickle cell disease 3A51.0-3A51.3 Peripheral blood 4.30E-02 -1.76E-01 -1.17E+00
Simpson golabi behmel syndrome LD2C Adipose tissue 3.36E-01 -2.85E-01 -6.19E-01
Sjogren's syndrome 4A43.2 Salivary gland tissue 3.67E-02 -3.66E-01 -2.53E+00
Skin cancer 2C30-2C3Z Skin 6.25E-32 -6.83E-01 -1.06E+00
Thrombocythemia 3B63 Whole blood 1.21E-01 -4.21E-02 -1.49E-01
Thrombocytopenia 3B64 Whole blood 2.69E-01 2.16E+00 1.17E+00
Thyroid cancer 2D10 Thyroid 3.72E-30 -1.05E+00 -1.89E+00
Tibial muscular dystrophy 8C75 Muscle tissue 3.54E-01 -1.14E-01 -5.63E-01
Tuberous sclerosis complex LD2D.2 Perituberal tissue 5.49E-01 6.13E-02 3.46E-01
Type 2 diabetes 5A11 Liver tissue 8.83E-01 2.60E-04 1.60E-03
Ureter cancer 2C92 Urothelium 5.97E-01 -5.39E-02 -2.00E-01
Uterine cancer 2C78 Endometrium tissue 5.99E-02 2.57E-01 3.40E-01
Vitiligo ED63.0 Skin 1.87E-01 -6.24E-01 -6.58E-01
------------------------------------------------------------------------------------
⏷ Show the Full List of DME Expression Under 107 Diseases

References

1 Nitrite reductase and nitric-oxide synthase activity of the mitochondrial molybdopterin enzymes mARC1 and mARC2. J Biol Chem. 2014 Apr 11;289(15):10345-58.