Details of Drug-Metabolizing Enzyme (DME)

General Information of Drug-Metabolizing Enzyme (DME) (ID: DE2HB58)

DME Name Nicotinate-nucleotide adenylyltransferase 2 (NMNAT2)
Synonyms
NMN adenylyltransferase 2; NMN/NaMN adenylyltransferase 2; NaMN adenylyltransferase 2; Nicotinamide mononucleotide adenylyltransferase 2; Nicotinamide/nicotinic acid mononucleotide adenylyltransferase 2; NMNAT2; C1orf15; KIAA0479
Gene Name NMNAT2
UniProt ID
NMNA2_HUMAN
INTEDE ID
DME0539
3D Structure
Download
2D Sequence (FASTA)
Download
3D Structure (PDB)
Download
Gene ID
23057
EC Number EC: 2.7.7.1
Transferase
Kinase
Nucleotidyltransferase
EC: 2.7.7.1
Lineage Species: Homo sapiens
Kingdom: Metazoa
Phylum: Chordata
Class: Mammalia
Order: Primates
Family: Hominidae
Genus: Homo
Species: Homo sapiens
Sequence
MTETTKTHVILLACGSFNPITKGHIQMFERARDYLHKTGRFIVIGGIVSPVHDSYGKQGL
VSSRHRLIMCQLAVQNSDWIRVDPWECYQDTWQTTCSVLEHHRDLMKRVTGCILSNVNTP
SMTPVIGQPQNETPQPIYQNSNVATKPTAAKILGKVGESLSRICCVRPPVERFTFVDENA
NLGTVMRYEEIELRILLLCGSDLLESFCIPGLWNEADMEVIVGDFGIVVVPRDAADTDRI
MNHSSILRKYKNNIMVVKDDINHPMSVVSSTKSRLALQHGDGHVVDYLSQPVIDYILKSQ
LYINASG
Function
This enzyme catalyzes the formation of NAD(+) from nicotinamide mononucleotide (NMN) and ATP. It can also use the deamidated form; nicotinic acid mononucleotide (NaMN) as substrate but with a lower efficiency but cannot use triazofurin monophosphate (TrMP) as substrate. It also catalyzes the reverse reaction, i.e. the pyrophosphorolytic cleavage of NAD(+).
KEGG Pathway
Metabolic pathways (hsa01100 )
Nicotinate and nicotinamide metabolism (hsa00760 )
Reactome Pathway
Nicotinate metabolism (R-HSA-196807 )

Molecular Interaction Atlas (MIA) of This DME

Molecular Interaction Atlas (MIA) Jump to Detail Molecular Interaction Atlas of This DME
1 Investigative Drug(s) Metabolized by This DME
Drug Name Drug ID Indication ICD 11 Highest Status REF
Namn DM1EZ3N Discovery agent N.A. Investigative [1]
Experimental Enzyme Kinetic Data of Drugs
Drug Name Indication Highest Status Kinetic Data REF
Namn Discovery agent [N.A.] Investigative Km = 0.0145 microM [1]

Molecular Expression Atlas (MEA) of This DME

Molecular Expression Atlas (MEA) Jump to Detail Molecular Expression Atlas of This DME
Disease Name ICD 11 Studied Tissue p-value Fold-Change Z-score
Acute myelocytic leukaemia 2B33.1 Bone marrow 8.13E-01 1.72E-02 1.02E-01
Alopecia ED70 Skin from scalp 1.76E-01 1.27E-01 3.36E-01
Alzheimer's disease 8A20 Entorhinal cortex 1.50E-08 -9.26E-01 -1.02E+00
Ankylosing spondylitis FA92.0 Pheripheral blood 9.06E-01 -9.09E-02 -6.31E-01
Aortic stenosis BB70 Calcified aortic valve 6.39E-01 2.27E-01 3.98E-01
Apnea 7A40 Hyperplastic tonsil 6.91E-01 -4.22E-02 -2.64E-01
Arthropathy FA00-FA5Z Peripheral blood 4.89E-01 1.63E-02 1.47E-01
Asthma CA23 Nasal and bronchial airway 3.01E-04 -9.44E-02 -2.25E-01
Atopic dermatitis EA80 Skin 2.56E-01 -1.59E-02 -1.80E-01
Autism 6A02 Whole blood 7.33E-02 -6.19E-02 -2.96E-01
Autoimmune uveitis 9A96 Peripheral monocyte 4.55E-02 -1.17E-01 -8.93E-01
Autosomal dominant monocytopenia 4B04 Whole blood 9.25E-01 1.07E-01 8.06E-01
Bacterial infection of gingival 1C1H Gingival tissue 6.39E-02 6.06E-02 2.30E-01
Batten disease 5C56.1 Whole blood 7.37E-01 -1.64E-02 -1.99E-01
Behcet's disease 4A62 Peripheral blood 8.94E-01 -3.98E-02 -2.80E-01
Bipolar disorder 6A60-6A6Z Prefrontal cortex 6.82E-01 -5.43E-02 -1.33E-01
Bladder cancer 2C94 Bladder tissue 1.41E-05 6.78E-01 3.12E+00
Breast cancer 2C60-2C6Z Breast tissue 2.14E-58 -5.55E-01 -1.39E+00
Cardioembolic stroke 8B11.20 Whole blood 6.53E-06 2.68E-01 1.17E+00
Cervical cancer 2C77 Cervical tissue 8.44E-01 7.92E-02 4.23E-01
Childhood onset rheumatic disease FA20.Z Peripheral blood 6.49E-01 -1.81E-02 -8.17E-02
Chronic hepatitis C 1E51.1 Whole blood 7.65E-01 -2.12E-02 -1.33E-01
Chronic obstructive pulmonary disease CA22 Lung tissue 1.21E-01 5.99E-02 4.14E-01
Chronic obstructive pulmonary disease CA22 Small airway epithelium 3.72E-04 1.28E-01 8.26E-01
Chronic rhinosinusitis CA0A Sinus mucosa tissue 6.27E-01 -8.51E-02 -7.93E-01
Colon cancer 2B90 Colon tissue 8.36E-15 1.51E-01 6.69E-01
Coronary artery disease BA80-BA8Z Peripheral blood 9.31E-01 6.42E-03 3.04E-02
Diffuse large B-cell lymphoma 2A81 Tonsil tissue 8.32E-01 2.45E-02 1.78E-01
Endometriosis GA10 Endometrium tissue 4.79E-01 1.05E-01 3.26E-01
Familial hypercholesterolemia 5C80.00 Peripheral blood 6.38E-02 -8.16E-02 -6.58E-01
Familial hypercholesterolemia 5C80.00 Whole blood 1.39E-03 -2.96E-01 -1.71E+00
Gastric cancer 2B72 Gastric tissue 5.70E-01 -2.79E-01 -3.87E-01
Glioblastopma 2A00.00 Nervous tissue 3.51E-102 -1.66E+00 -1.54E+00
Glioma 2A00.0Y-2A00.0Z Brain stem tissue 1.64E-01 -1.59E-01 -1.09E+00
Glioma 2A00.0Y-2A00.0Z White matter tissue 9.80E-03 8.60E-01 1.47E+00
Head and neck cancer 2D42 Head and neck tissue 1.04E-03 1.06E-01 5.53E-01
HIV-associated neurocognitive impairment 8A2Y-8A2Z White matter tissue 1.78E-01 -7.13E-01 -7.93E-01
Huntington's disease 8A01.10 Whole blood 3.16E-02 9.32E-02 1.07E+00
Idiopathic pulmonary fibrosis CB03.4 Lung tissue 1.37E-01 1.57E-01 6.68E-01
Immunodeficiency 4A00-4A20 Peripheral blood 2.49E-01 8.56E-02 1.37E+00
Influenza 1E30 Whole blood 3.52E-01 2.38E-01 1.14E+00
Interstitial cystitis GC00.3 Bladder tissue 1.20E-01 1.63E-01 1.15E+00
Intracranial aneurysm 8B01.0 Intracranial artery 4.11E-02 -6.67E-01 -9.93E-01
Irritable bowel syndrome DD91.0 Rectal colon tissue 7.83E-02 1.25E-01 3.82E-01
Ischemic stroke 8B11 Peripheral blood 5.77E-01 9.09E-03 6.52E-02
Juvenile idiopathic arthritis FA24 Peripheral blood 1.28E-04 9.61E-02 5.53E-01
Lateral sclerosis 8B60.4 Skin 6.86E-01 3.41E-01 5.15E-01
Lateral sclerosis 8B60.4 Cervical spinal cord 9.49E-01 5.16E-02 8.78E-02
Liver cancer 2C12.0 Liver tissue 3.75E-02 -9.99E-02 -6.05E-01
Liver failure DB99.7-DB99.8 Liver tissue 1.44E-01 8.04E-02 6.23E-01
Lung cancer 2C25 Lung tissue 1.33E-30 7.81E-02 4.15E-01
Lupus erythematosus 4A40 Whole blood 1.99E-01 -9.04E-02 -2.25E-01
Major depressive disorder 6A70-6A7Z Hippocampus 9.21E-01 -5.83E-02 -1.53E-01
Major depressive disorder 6A70-6A7Z Whole blood 1.52E-02 7.38E-02 3.79E-01
Melanoma 2C30 Skin 8.03E-01 -5.14E-02 -1.28E-01
Multiple myeloma 2A83.1 Peripheral blood 1.89E-01 2.48E-02 1.92E-01
Multiple myeloma 2A83.1 Bone marrow 5.42E-03 -2.89E-01 -1.51E+00
Multiple sclerosis 8A40 Plasmacytoid dendritic cells 4.94E-01 1.73E-01 8.90E-01
Myelodysplastic syndrome 2A36-2A3Z Bone marrow 7.50E-01 4.72E-03 2.20E-02
Myelofibrosis 2A20.2 Whole blood 3.47E-02 -1.23E-01 -1.47E+00
Myocardial infarction BA41-BA50 Peripheral blood 3.81E-01 1.88E-01 4.41E-01
Myopathy 8C70.6 Muscle tissue 4.92E-01 -8.93E-02 -5.82E-01
Neonatal sepsis KA60 Whole blood 6.60E-10 1.46E-01 9.73E-01
Neuroectodermal tumour 2A00.11 Brain stem tissue 2.33E-01 1.37E-02 5.72E-02
Non-alcoholic fatty liver disease DB92 Liver tissue 4.06E-01 -1.03E-02 -7.26E-02
Obesity related type 2 diabetes 5A11 Omental adipose tissue 1.74E-01 8.12E-02 3.03E-01
Olive pollen allergy CA08.00 Peripheral blood 1.97E-01 1.65E-01 1.06E+00
Oral cancer 2B6E Oral tissue 8.71E-01 -4.03E-02 -1.61E-01
Osteoarthritis FA00-FA0Z Synovial tissue 7.18E-01 -6.51E-02 -5.65E-01
Osteoporosis FB83.1 Bone marrow 6.64E-01 9.80E-03 5.69E-02
Ovarian cancer 2C73 Ovarian tissue 1.81E-04 1.84E-01 6.79E-01
Pancreatic cancer 2C10 Pancreas 1.95E-01 -1.33E-01 -4.18E-01
Parkinson's disease 8A00.0 Substantia nigra tissue 5.98E-02 -6.92E-01 -1.04E+00
Pediatric respiratory syncytial virus infection CA40.11 Peripheral blood 8.56E-01 -1.65E-02 -1.37E-01
Pituitary cancer 2D12 Pituitary tissue 4.17E-01 2.04E-01 4.72E-01
Pituitary gonadotrope tumour 2D12 Pituitary tissue 4.48E-02 2.47E-01 8.06E-01
Polycystic ovary syndrome 5A80.1 Vastus lateralis muscle 5.67E-01 3.83E-02 2.99E-01
Polycythemia vera 2A20.4 Whole blood 1.94E-03 -3.86E-02 -4.09E-01
Pompe disease 5C51.3 Biceps muscle 4.34E-01 1.48E-01 6.81E-01
Preterm birth KA21.4Z Myometrium 5.32E-01 -2.98E-02 -1.63E-01
Prostate cancer 2C82 Prostate 1.11E-03 -5.19E-01 -1.41E+00
Psoriasis EA90 Skin 2.69E-04 -1.25E-01 -5.39E-01
Rectal cancer 2B92 Rectal colon tissue 7.88E-01 6.35E-02 3.04E-01
Renal cancer 2C90-2C91 Kidney 1.13E-01 -3.54E-02 -1.55E-01
Retinoblastoma 2D02.2 Uvea 5.00E-06 -8.57E-01 -2.17E+00
Rheumatoid arthritis FA20 Synovial tissue 4.67E-01 -1.77E-02 -1.54E-01
Rhinovirus infection CA42.1 Nasal epithelium tissue 4.21E-01 -2.24E-02 -2.01E-01
Schizophrenia 6A20 Prefrontal cortex 9.41E-02 -2.54E-01 -1.81E-01
Schizophrenia 6A20 Superior temporal cortex 5.06E-01 1.40E-02 2.75E-02
Scleroderma 4A42.Z Whole blood 8.51E-01 -1.54E-02 -1.06E-01
Seizure 8A60-8A6Z Whole blood 3.86E-01 -3.83E-02 -2.75E-01
Sensitive skin EK0Z Skin 7.69E-01 -1.67E-02 -1.08E-01
Sepsis with septic shock 1G41 Whole blood 4.06E-30 2.23E-01 1.22E+00
Shwachman-Diamond syndrome 3A70.0 Bone marrow 1.24E-01 7.42E-01 1.41E+00
Sickle cell disease 3A51.0-3A51.3 Peripheral blood 7.79E-01 3.28E-02 2.55E-01
Simpson golabi behmel syndrome LD2C Adipose tissue 8.35E-01 -8.58E-02 -4.29E-01
Sjogren's syndrome 4A43.2 Salivary gland tissue 4.59E-01 -4.03E-02 -2.29E-01
Skin cancer 2C30-2C3Z Skin 5.35E-03 -2.00E-01 -8.32E-01
Thrombocythemia 3B63 Whole blood 9.72E-01 -2.41E-02 -2.55E-01
Thrombocytopenia 3B64 Whole blood 4.26E-01 2.38E-01 1.03E+00
Thyroid cancer 2D10 Thyroid 1.52E-06 -6.28E-01 -1.15E+00
Tibial muscular dystrophy 8C75 Muscle tissue 7.71E-01 2.27E-02 1.53E-01
Tuberous sclerosis complex LD2D.2 Perituberal tissue 4.71E-03 -1.48E+00 -2.83E+00
Type 2 diabetes 5A11 Liver tissue 3.28E-01 -7.29E-02 -5.80E-01
Ureter cancer 2C92 Urothelium 7.89E-01 -6.63E-03 -3.35E-02
Uterine cancer 2C78 Endometrium tissue 5.47E-01 -2.56E-02 -1.27E-01
Vitiligo ED63.0 Skin 1.26E-01 -5.68E-01 -1.20E+00
------------------------------------------------------------------------------------
⏷ Show the Full List of DME Expression Under 107 Diseases

References

1 Initial-rate kinetics of human NMN-adenylyltransferases: substrate and metal ion specificity, inhibition by products and multisubstrate analogues, and isozyme contributions to NAD+ biosynthesis. Biochemistry. 2007 Apr 24;46(16):4912-22.