General Information of Drug-Metabolizing Enzyme (DME) (ID: DE2L4RX)

DME Name Prolyl 4-hydroxylase alpha-3 (P4HA3)
Synonyms Procollagen-proline,2-oxoglutarate-4-dioxygenase subunit alpha-3; Prolyl 4-hydroxylase subunit alpha-3; 4-PH alpha-3; P4HA3; UNQ711/PRO1374
Gene Name P4HA3
UniProt ID
P4HA3_HUMAN
INTEDE ID
DME0463
3D Structure
Download
2D Sequence (FASTA)
Download
3D Structure (PDB)
Download
Gene ID
283208
EC Number EC: 1.14.11.2
Oxidoreductase
Oxygen paired donor oxidoreductase
2-oxoglutarate donor oxidoreductase
EC: 1.14.11.2
Lineage Species: Homo sapiens
Kingdom: Metazoa
Phylum: Chordata
Class: Mammalia
Order: Primates
Family: Hominidae
Genus: Homo
Species: Homo sapiens
Sequence
MGPGARLAALLAVLALGTGDPERAAARGDTFSALTSVARALAPERRLLGLLRRYLRGEEA
RLRDLTRFYDKVLSLHEDSTTPVANPLLAFTLIKRLQSDWRNVVHSLEASENIRALKDGY
EKVEQDLPAFEDLEGAARALMRLQDVYMLNVKGLARGVFQRVTGSAITDLYSPKRLFSLT
GDDCFQVGKVAYDMGDYYHAIPWLEEAVSLFRGSYGEWKTEDEASLEDALDHLAFAYFRA
GNVSCALSLSREFLLYSPDNKRMARNVLKYERLLAESPNHVVAEAVIQRPNIPHLQTRDT
YEGLCQTLGSQPTLYQIPSLYCSYETNSNAYLLLQPIRKEVIHLEPYIALYHDFVSDSEA
QKIRELAEPWLQRSVVASGEKQLQVEYRISKSAWLKDTVDPKLVTLNHRIAALTGLDVRP
PYAEYLQVVNYGIGGHYEPHFDHATSPSSPLYRMKSGNRVATFMIYLSSVEAGGATAFIY
ANLSVPVVRNAALFWWNLHRSGEGDSDTLHAGCPVLVGDKWVANKWIHEYGQEFRRPCSS
SPED
Function This enzyme catalyzes the post-translational formation of 4- hydroxyproline in -Xaa-Pro-Gly- sequences in collagens and other proteins.
KEGG Pathway
Arginine and proline metabolism (hsa00330 )
Metabolic pathways (hsa01100 )
Reactome Pathway
Collagen biosynthesis and modifying enzymes (R-HSA-1650814 )

Molecular Interaction Atlas (MIA) of This DME

Molecular Interaction Atlas (MIA) Jump to Detail Molecular Interaction Atlas of This DME
1 Approved Drug(s) Metabolized by This DME
Drug Name Drug ID Indication ICD 11 Highest Status REF
Vitamin C DMXJ7O8 Adenocarcinoma 2D40 Approved [1]
1 Investigative Drug(s) Metabolized by This DME
Drug Name Drug ID Indication ICD 11 Highest Status REF
alpha-ketoglutaric acid DM5LFYN Discovery agent N.A. Investigative [1]
Experimental Enzyme Kinetic Data of Drugs
Drug Name Indication Highest Status Kinetic Data REF
alpha-ketoglutaric acid Discovery agent [N.A.] Investigative Km = 0.06 microM [1]
Vitamin C Adenocarcinoma [2D40] Approved Km = 0.18 microM [1]

Molecular Expression Atlas (MEA) of This DME

Molecular Expression Atlas (MEA) Jump to Detail Molecular Expression Atlas of This DME
Disease Name ICD 11 Studied Tissue p-value Fold-Change Z-score
Acute myelocytic leukaemia 2B33.1 Bone marrow 6.13E-02 3.24E-02 1.91E-01
Alopecia ED70 Skin from scalp 5.72E-06 -2.53E-01 -1.21E+00
Alzheimer's disease 8A20 Entorhinal cortex 7.48E-01 1.32E-02 9.50E-02
Ankylosing spondylitis FA92.0 Pheripheral blood 7.65E-01 2.17E-02 2.26E-01
Aortic stenosis BB70 Calcified aortic valve 8.18E-02 1.57E-01 5.53E-01
Apnea 7A40 Hyperplastic tonsil 2.29E-01 -2.98E-01 -1.01E+00
Arthropathy FA00-FA5Z Peripheral blood 2.33E-01 -1.81E-02 -1.46E-01
Asthma CA23 Nasal and bronchial airway 4.29E-09 -5.09E-01 -7.65E-01
Atopic dermatitis EA80 Skin 5.80E-06 1.60E-01 1.70E+00
Autism 6A02 Whole blood 4.43E-02 -1.09E-01 -5.00E-01
Autoimmune uveitis 9A96 Peripheral monocyte 1.30E-01 -8.02E-02 -4.94E-01
Autosomal dominant monocytopenia 4B04 Whole blood 4.38E-01 -4.77E-02 -4.40E-01
Bacterial infection of gingival 1C1H Gingival tissue 3.97E-07 2.74E-01 8.77E-01
Batten disease 5C56.1 Whole blood 8.88E-01 -3.02E-02 -3.46E-01
Behcet's disease 4A62 Peripheral blood 2.88E-01 9.53E-02 6.40E-01
Bipolar disorder 6A60-6A6Z Prefrontal cortex 3.25E-01 -1.15E-03 -8.68E-03
Bladder cancer 2C94 Bladder tissue 3.76E-04 6.72E-01 2.15E+00
Breast cancer 2C60-2C6Z Breast tissue 6.30E-17 2.21E-01 6.78E-01
Cardioembolic stroke 8B11.20 Whole blood 2.37E-01 -9.94E-02 -5.90E-01
Cervical cancer 2C77 Cervical tissue 1.01E-01 1.04E-01 4.90E-01
Childhood onset rheumatic disease FA20.Z Peripheral blood 5.67E-01 1.78E-02 9.11E-02
Chronic hepatitis C 1E51.1 Whole blood 1.60E-01 8.35E-02 4.89E-01
Chronic obstructive pulmonary disease CA22 Lung tissue 7.19E-01 5.18E-02 2.78E-01
Chronic obstructive pulmonary disease CA22 Small airway epithelium 9.77E-01 -1.00E-02 -5.98E-02
Chronic rhinosinusitis CA0A Sinus mucosa tissue 2.32E-01 1.40E-01 6.46E-01
Colon cancer 2B90 Colon tissue 2.01E-07 7.99E-02 3.71E-01
Coronary artery disease BA80-BA8Z Peripheral blood 2.31E-01 -9.64E-02 -8.40E-01
Diffuse large B-cell lymphoma 2A81 Tonsil tissue 3.76E-01 -8.77E-02 -5.47E-01
Endometriosis GA10 Endometrium tissue 1.07E-06 3.14E-01 1.18E+00
Familial hypercholesterolemia 5C80.00 Peripheral blood 7.04E-01 -1.11E-02 -1.05E-01
Familial hypercholesterolemia 5C80.00 Whole blood 3.07E-04 -3.03E-01 -1.22E+00
Gastric cancer 2B72 Gastric tissue 3.16E-02 6.02E-02 1.70E+00
Glioblastopma 2A00.00 Nervous tissue 4.04E-01 4.43E-02 1.44E-01
Glioma 2A00.0Y-2A00.0Z Brain stem tissue 8.03E-01 -4.88E-02 -2.42E-01
Glioma 2A00.0Y-2A00.0Z White matter tissue 8.19E-02 -1.36E-01 -7.21E-01
Head and neck cancer 2D42 Head and neck tissue 6.11E-10 2.13E-01 1.03E+00
HIV-associated neurocognitive impairment 8A2Y-8A2Z White matter tissue 9.78E-02 -1.13E-01 -4.38E-01
Huntington's disease 8A01.10 Whole blood 8.61E-01 -1.66E-02 -1.33E-01
Idiopathic pulmonary fibrosis CB03.4 Lung tissue 7.07E-01 2.08E-01 5.20E-01
Immunodeficiency 4A00-4A20 Peripheral blood 4.95E-01 9.72E-03 7.87E-02
Influenza 1E30 Whole blood 1.27E-02 3.93E-01 4.35E+00
Interstitial cystitis GC00.3 Bladder tissue 4.40E-03 7.12E-01 5.16E+00
Intracranial aneurysm 8B01.0 Intracranial artery 2.67E-05 7.50E-01 2.49E+00
Irritable bowel syndrome DD91.0 Rectal colon tissue 6.48E-01 -2.13E-02 -7.87E-02
Ischemic stroke 8B11 Peripheral blood 2.82E-01 8.20E-02 5.35E-01
Juvenile idiopathic arthritis FA24 Peripheral blood 5.11E-01 1.90E-02 9.98E-02
Lateral sclerosis 8B60.4 Skin 2.26E-01 -1.01E-01 -5.69E-01
Lateral sclerosis 8B60.4 Cervical spinal cord 5.28E-01 -6.63E-02 -2.33E-01
Liver cancer 2C12.0 Liver tissue 2.73E-06 -1.61E-01 -7.89E-01
Liver failure DB99.7-DB99.8 Liver tissue 2.24E-01 1.44E-01 7.07E-01
Lung cancer 2C25 Lung tissue 7.96E-29 3.37E-01 1.15E+00
Lupus erythematosus 4A40 Whole blood 6.51E-01 -6.75E-02 -1.41E-01
Major depressive disorder 6A70-6A7Z Hippocampus 5.09E-01 2.84E-02 2.12E-01
Major depressive disorder 6A70-6A7Z Whole blood 2.02E-01 1.51E-02 5.83E-02
Melanoma 2C30 Skin 5.41E-02 6.25E-01 9.55E-01
Multiple myeloma 2A83.1 Peripheral blood 1.31E-01 1.14E-01 8.01E-01
Multiple myeloma 2A83.1 Bone marrow 1.41E-03 -4.98E-01 -2.02E+00
Multiple sclerosis 8A40 Plasmacytoid dendritic cells 2.79E-02 2.95E-01 1.20E+00
Myelodysplastic syndrome 2A36-2A3Z Bone marrow 8.16E-01 6.72E-03 4.67E-02
Myelofibrosis 2A20.2 Whole blood 2.63E-02 1.42E-01 9.92E-01
Myocardial infarction BA41-BA50 Peripheral blood 8.01E-01 -3.05E-03 -4.25E-03
Myopathy 8C70.6 Muscle tissue 9.88E-01 -5.70E-02 -5.00E-01
Neonatal sepsis KA60 Whole blood 8.62E-01 -5.81E-02 -2.43E-01
Neuroectodermal tumour 2A00.11 Brain stem tissue 1.75E-05 -1.02E+00 -2.90E+00
Non-alcoholic fatty liver disease DB92 Liver tissue 9.01E-02 -9.35E-02 -7.26E-01
Obesity related type 2 diabetes 5A11 Omental adipose tissue 1.07E-02 2.02E-01 3.07E+00
Olive pollen allergy CA08.00 Peripheral blood 1.68E-01 2.68E-01 1.90E+00
Oral cancer 2B6E Oral tissue 4.33E-02 4.12E-02 1.64E-01
Osteoarthritis FA00-FA0Z Synovial tissue 6.52E-02 2.72E-01 8.60E-01
Osteoporosis FB83.1 Bone marrow 2.58E-01 9.32E-02 4.12E-01
Ovarian cancer 2C73 Ovarian tissue 8.91E-01 -6.86E-02 -2.69E-01
Pancreatic cancer 2C10 Pancreas 1.41E-02 1.37E-01 5.15E-01
Parkinson's disease 8A00.0 Substantia nigra tissue 2.60E-01 -7.07E-02 -4.69E-01
Pediatric respiratory syncytial virus infection CA40.11 Peripheral blood 6.58E-01 2.69E-02 3.41E-01
Pituitary cancer 2D12 Pituitary tissue 2.13E-01 -8.54E-02 -3.96E-01
Pituitary gonadotrope tumour 2D12 Pituitary tissue 4.62E-02 -2.39E-01 -1.17E+00
Polycystic ovary syndrome 5A80.1 Vastus lateralis muscle 3.17E-01 2.49E-03 2.00E-02
Polycythemia vera 2A20.4 Whole blood 8.80E-11 2.78E-01 1.69E+00
Pompe disease 5C51.3 Biceps muscle 1.89E-01 -1.08E-01 -7.04E-01
Preterm birth KA21.4Z Myometrium 1.63E-02 -3.73E-01 -1.23E+00
Prostate cancer 2C82 Prostate 3.03E-01 -1.19E-01 -2.78E-01
Psoriasis EA90 Skin 2.41E-14 -1.08E-01 -4.53E-01
Rectal cancer 2B92 Rectal colon tissue 1.63E-02 1.87E-01 1.22E+00
Renal cancer 2C90-2C91 Kidney 9.74E-01 9.39E-05 3.35E-04
Retinoblastoma 2D02.2 Uvea 5.67E-01 -1.06E-01 -1.19E+00
Rheumatoid arthritis FA20 Synovial tissue 1.00E-01 2.10E-01 6.96E-01
Rhinovirus infection CA42.1 Nasal epithelium tissue 8.33E-01 2.19E-03 1.64E-02
Schizophrenia 6A20 Prefrontal cortex 5.11E-01 1.30E-02 4.18E-02
Schizophrenia 6A20 Superior temporal cortex 3.15E-01 -5.03E-02 -4.21E-01
Scleroderma 4A42.Z Whole blood 1.57E-03 2.27E-01 1.94E+00
Seizure 8A60-8A6Z Whole blood 7.78E-01 4.23E-02 1.97E-01
Sensitive skin EK0Z Skin 3.61E-01 4.59E-02 3.53E-01
Sepsis with septic shock 1G41 Whole blood 5.33E-02 5.51E-02 2.18E-01
Shwachman-Diamond syndrome 3A70.0 Bone marrow 8.90E-02 3.68E-01 1.63E+00
Sickle cell disease 3A51.0-3A51.3 Peripheral blood 8.38E-01 -2.21E-02 -9.27E-02
Simpson golabi behmel syndrome LD2C Adipose tissue 1.61E-01 1.43E-01 8.43E-01
Sjogren's syndrome 4A43.2 Salivary gland tissue 3.59E-01 2.97E-01 8.48E-01
Skin cancer 2C30-2C3Z Skin 6.80E-11 1.58E-01 5.15E-01
Thrombocythemia 3B63 Whole blood 6.00E-03 2.11E-01 1.41E+00
Thrombocytopenia 3B64 Whole blood 2.36E-01 1.29E-01 7.58E-01
Thyroid cancer 2D10 Thyroid 9.02E-01 -9.21E-02 -3.68E-01
Tibial muscular dystrophy 8C75 Muscle tissue 9.29E-01 -8.11E-02 -6.38E-01
Tuberous sclerosis complex LD2D.2 Perituberal tissue 2.53E-03 3.13E-01 7.38E+00
Type 2 diabetes 5A11 Liver tissue 9.00E-01 -1.75E-03 -1.56E-02
Ureter cancer 2C92 Urothelium 8.30E-02 -2.98E-02 -2.07E-01
Uterine cancer 2C78 Endometrium tissue 2.18E-03 1.22E-01 3.71E-01
Vitiligo ED63.0 Skin 9.96E-02 -2.33E-01 -7.17E-01
------------------------------------------------------------------------------------
⏷ Show the Full List of DME Expression Under 107 Diseases

References

1 Identification and characterization of a third human, rat, and mouse collagen prolyl 4-hydroxylase isoenzyme. J Biol Chem. 2003 Nov 28;278(48):47685-93.