Details of Drug-Metabolizing Enzyme (DME)

General Information of Drug-Metabolizing Enzyme (DME) (ID: DE2MV1R)

DME Name Adenine phosphoribosyltransferase (APRT)
Synonyms Adenine phosphoribosyltransferase enzyme; AMP; APRTD; APRTase; APRT
Gene Name APRT
UniProt ID
APT_HUMAN
INTEDE ID
DME0078
3D Structure
Download
2D Sequence (FASTA)
Download
3D Structure (PDB)
Download
Gene ID
353
EC Number EC: 2.4.2.7
Transferase
Glycosyltransferases
Pentosyltransferase
EC: 2.4.2.7
Lineage Species: Homo sapiens
Kingdom: Metazoa
Phylum: Chordata
Class: Mammalia
Order: Primates
Family: Hominidae
Genus: Homo
Species: Homo sapiens
Sequence
MADSELQLVEQRIRSFPDFPTPGVVFRDISPVLKDPASFRAAIGLLARHLKATHGGRIDY
IAGLDSRGFLFGPSLAQELGLGCVLIRKRGKLPGPTLWASYSLEYGKAELEIQKDALEPG
QRVVVVDDLLATGGTMNAACELLGRLQAEVLECVSLVELTSLKGREKLAPVPFFSLLQYE
Function This enzyme catalyzes a salvage reaction resulting in the formation of AMP, that is energically less costly than de novo synthesis.
KEGG Pathway
( )
( )
Reactome Pathway
Purine salvage (R-HSA-74217 )
Neutrophil degranulation (R-HSA-6798695 )

Molecular Interaction Atlas (MIA) of This DME

Molecular Interaction Atlas (MIA) Jump to Detail Molecular Interaction Atlas of This DME
1 Approved Drug(s) Metabolized by This DME
Drug Name Drug ID Indication ICD 11 Highest Status REF
Adenosine monophosphate DMNIJT0 Malnutrition 5B50-5B71 Approved [1]

Molecular Expression Atlas (MEA) of This DME

Molecular Expression Atlas (MEA) Jump to Detail Molecular Expression Atlas of This DME
Disease Name ICD 11 Studied Tissue p-value Fold-Change Z-score
Acute myelocytic leukaemia 2B33.1 Bone marrow 3.86E-33 6.46E-01 1.46E+00
Alopecia ED70 Skin from scalp 4.29E-02 -6.19E-02 -2.48E-01
Alzheimer's disease 8A20 Entorhinal cortex 8.81E-03 -1.13E-01 -5.73E-01
Ankylosing spondylitis FA92.0 Pheripheral blood 2.96E-01 2.47E-01 7.73E-01
Aortic stenosis BB70 Calcified aortic valve 4.76E-01 1.15E-01 2.29E-01
Apnea 7A40 Hyperplastic tonsil 5.10E-01 -1.08E-01 -2.88E-01
Arthropathy FA00-FA5Z Peripheral blood 1.35E-02 -3.70E-01 -1.77E+00
Asthma CA23 Nasal and bronchial airway 3.56E-07 3.76E-01 6.26E-01
Atopic dermatitis EA80 Skin 3.92E-05 5.37E-01 1.10E+00
Autism 6A02 Whole blood 2.25E-02 -1.33E-01 -2.93E-01
Autoimmune uveitis 9A96 Peripheral monocyte 2.00E-01 -2.41E-01 -9.29E-01
Autosomal dominant monocytopenia 4B04 Whole blood 9.86E-02 -5.15E-01 -1.44E+00
Bacterial infection of gingival 1C1H Gingival tissue 4.92E-05 -2.60E-01 -7.06E-01
Batten disease 5C56.1 Whole blood 1.32E-01 -1.02E-01 -5.34E-01
Behcet's disease 4A62 Peripheral blood 3.09E-01 -2.18E-02 -7.55E-02
Bipolar disorder 6A60-6A6Z Prefrontal cortex 8.46E-01 -5.18E-02 -3.06E-01
Bladder cancer 2C94 Bladder tissue 2.68E-02 3.28E-01 1.13E+00
Breast cancer 2C60-2C6Z Breast tissue 6.24E-26 3.12E-01 7.60E-01
Cardioembolic stroke 8B11.20 Whole blood 2.52E-13 -7.31E-01 -2.94E+00
Cervical cancer 2C77 Cervical tissue 9.18E-03 -5.22E-01 -8.92E-01
Childhood onset rheumatic disease FA20.Z Peripheral blood 4.34E-01 2.61E-01 2.85E-01
Chronic hepatitis C 1E51.1 Whole blood 6.35E-01 -4.10E-02 -2.02E-01
Chronic obstructive pulmonary disease CA22 Lung tissue 4.62E-02 -2.53E-01 -5.68E-01
Chronic obstructive pulmonary disease CA22 Small airway epithelium 3.07E-01 -1.82E-02 -5.35E-02
Chronic rhinosinusitis CA0A Sinus mucosa tissue 5.47E-02 3.04E-01 7.90E-01
Colon cancer 2B90 Colon tissue 3.09E-18 3.47E-01 8.96E-01
Coronary artery disease BA80-BA8Z Peripheral blood 1.03E-02 6.64E-01 1.91E+00
Diffuse large B-cell lymphoma 2A81 Tonsil tissue 9.80E-01 -6.62E-02 -1.22E-01
Endometriosis GA10 Endometrium tissue 4.34E-02 -9.78E-02 -2.70E-01
Familial hypercholesterolemia 5C80.00 Peripheral blood 2.50E-01 7.05E-02 6.17E-01
Familial hypercholesterolemia 5C80.00 Whole blood 8.77E-06 2.56E-01 1.34E+00
Gastric cancer 2B72 Gastric tissue 2.83E-01 6.73E-01 1.04E+00
Glioblastopma 2A00.00 Nervous tissue 7.09E-96 4.69E-01 1.67E+00
Glioma 2A00.0Y-2A00.0Z Brain stem tissue 7.37E-01 1.51E-01 4.49E-01
Glioma 2A00.0Y-2A00.0Z White matter tissue 1.38E-02 5.31E-01 1.06E+00
Head and neck cancer 2D42 Head and neck tissue 7.56E-07 2.85E-01 5.05E-01
HIV-associated neurocognitive impairment 8A2Y-8A2Z White matter tissue 2.34E-01 6.58E-03 2.16E-02
Huntington's disease 8A01.10 Whole blood 7.07E-01 1.96E-02 7.09E-02
Idiopathic pulmonary fibrosis CB03.4 Lung tissue 2.80E-01 9.80E-02 3.29E-01
Immunodeficiency 4A00-4A20 Peripheral blood 9.18E-01 6.27E-02 3.64E-01
Influenza 1E30 Whole blood 2.58E-02 -3.73E-01 -2.46E+00
Interstitial cystitis GC00.3 Bladder tissue 1.23E-01 -2.81E-01 -1.26E+00
Intracranial aneurysm 8B01.0 Intracranial artery 2.31E-04 4.66E-01 1.59E+00
Irritable bowel syndrome DD91.0 Rectal colon tissue 2.21E-01 -7.40E-01 -9.46E-01
Ischemic stroke 8B11 Peripheral blood 8.87E-01 -5.52E-02 -2.17E-01
Juvenile idiopathic arthritis FA24 Peripheral blood 2.42E-12 -1.13E+00 -1.48E+00
Lateral sclerosis 8B60.4 Skin 1.93E-02 3.30E-01 2.03E+00
Lateral sclerosis 8B60.4 Cervical spinal cord 5.52E-01 3.46E-01 7.62E-01
Liver cancer 2C12.0 Liver tissue 2.65E-01 1.22E-01 3.63E-01
Liver failure DB99.7-DB99.8 Liver tissue 7.92E-01 4.33E-02 9.89E-02
Lung cancer 2C25 Lung tissue 7.80E-38 3.76E-01 1.23E+00
Lupus erythematosus 4A40 Whole blood 5.25E-01 2.22E-01 3.30E-01
Major depressive disorder 6A70-6A7Z Hippocampus 9.49E-01 9.95E-03 6.14E-02
Major depressive disorder 6A70-6A7Z Whole blood 4.39E-01 -1.46E-01 -1.81E-01
Melanoma 2C30 Skin 6.38E-01 -1.83E-01 -2.74E-01
Multiple myeloma 2A83.1 Peripheral blood 1.80E-01 -7.95E-02 -5.82E-01
Multiple myeloma 2A83.1 Bone marrow 1.55E-05 9.91E-01 3.40E+00
Multiple sclerosis 8A40 Plasmacytoid dendritic cells 8.35E-01 -2.91E-02 -1.25E-01
Myelodysplastic syndrome 2A36-2A3Z Bone marrow 3.53E-01 1.13E-01 2.89E-01
Myelofibrosis 2A20.2 Whole blood 8.67E-01 -4.04E-02 -2.31E-01
Myocardial infarction BA41-BA50 Peripheral blood 8.92E-03 -6.72E-01 -7.05E-01
Myopathy 8C70.6 Muscle tissue 3.39E-03 2.08E-01 1.13E+00
Neonatal sepsis KA60 Whole blood 2.65E-34 -8.24E-01 -2.67E+00
Neuroectodermal tumour 2A00.11 Brain stem tissue 2.71E-14 7.66E-01 5.76E+00
Non-alcoholic fatty liver disease DB92 Liver tissue 4.85E-01 -2.62E-01 -6.57E-01
Obesity related type 2 diabetes 5A11 Omental adipose tissue 6.91E-01 4.69E-02 2.99E-01
Olive pollen allergy CA08.00 Peripheral blood 8.68E-01 -6.19E-02 -9.42E-02
Oral cancer 2B6E Oral tissue 3.43E-01 3.99E-02 7.78E-02
Osteoarthritis FA00-FA0Z Synovial tissue 3.37E-01 2.66E-01 2.24E-01
Osteoporosis FB83.1 Bone marrow 3.70E-01 1.72E-01 6.00E-01
Ovarian cancer 2C73 Ovarian tissue 4.79E-04 6.74E-01 2.09E+00
Pancreatic cancer 2C10 Pancreas 4.31E-01 4.65E-02 1.04E-01
Parkinson's disease 8A00.0 Substantia nigra tissue 3.77E-01 -6.57E-02 -3.43E-01
Pediatric respiratory syncytial virus infection CA40.11 Peripheral blood 4.87E-02 -1.73E-01 -9.22E-01
Pituitary cancer 2D12 Pituitary tissue 2.49E-02 1.91E-01 8.00E-01
Pituitary gonadotrope tumour 2D12 Pituitary tissue 9.59E-01 -4.36E-02 -1.67E-01
Polycystic ovary syndrome 5A80.1 Vastus lateralis muscle 5.62E-01 -7.51E-02 -2.68E-01
Polycythemia vera 2A20.4 Whole blood 4.19E-06 -1.49E-01 -8.86E-01
Pompe disease 5C51.3 Biceps muscle 9.69E-03 2.94E-01 1.68E+00
Preterm birth KA21.4Z Myometrium 6.75E-03 -4.35E-01 -1.72E+00
Prostate cancer 2C82 Prostate 6.19E-07 1.00E+00 1.89E+00
Psoriasis EA90 Skin 5.89E-26 5.50E-01 1.61E+00
Rectal cancer 2B92 Rectal colon tissue 8.48E-01 -2.00E-02 -8.60E-02
Renal cancer 2C90-2C91 Kidney 1.09E-06 3.50E-01 2.33E+00
Retinoblastoma 2D02.2 Uvea 5.74E-14 1.99E+00 1.26E+01
Rheumatoid arthritis FA20 Synovial tissue 1.82E-08 1.31E+00 7.87E+00
Rhinovirus infection CA42.1 Nasal epithelium tissue 8.91E-01 -3.29E-03 -2.55E-02
Schizophrenia 6A20 Prefrontal cortex 2.95E-01 -3.59E-03 -3.75E-03
Schizophrenia 6A20 Superior temporal cortex 5.90E-01 1.17E-02 1.22E-01
Scleroderma 4A42.Z Whole blood 9.40E-01 -1.13E-02 -6.29E-02
Seizure 8A60-8A6Z Whole blood 4.36E-01 5.42E-01 1.09E+00
Sensitive skin EK0Z Skin 1.23E-01 2.03E-01 9.32E-01
Sepsis with septic shock 1G41 Whole blood 7.68E-67 -7.24E-01 -2.16E+00
Shwachman-Diamond syndrome 3A70.0 Bone marrow 1.19E-01 -9.48E-02 -8.79E-01
Sickle cell disease 3A51.0-3A51.3 Peripheral blood 2.37E-02 -2.96E-01 -8.28E-01
Simpson golabi behmel syndrome LD2C Adipose tissue 9.19E-01 -2.07E-01 -4.43E-01
Sjogren's syndrome 4A43.2 Salivary gland tissue 2.88E-01 -4.74E-01 -1.42E+00
Skin cancer 2C30-2C3Z Skin 2.40E-04 -1.21E-01 -3.05E-01
Thrombocythemia 3B63 Whole blood 2.00E-01 -4.21E-02 -2.42E-01
Thrombocytopenia 3B64 Whole blood 5.59E-01 3.78E-01 2.61E-01
Thyroid cancer 2D10 Thyroid 7.69E-03 8.01E-02 3.00E-01
Tibial muscular dystrophy 8C75 Muscle tissue 3.05E-05 2.07E-01 1.23E+00
Tuberous sclerosis complex LD2D.2 Perituberal tissue 5.90E-01 -1.22E-01 -8.47E-01
Type 2 diabetes 5A11 Liver tissue 1.47E-01 -2.26E-01 -7.63E-01
Ureter cancer 2C92 Urothelium 6.33E-01 -5.71E-02 -2.36E-01
Uterine cancer 2C78 Endometrium tissue 2.21E-13 -4.84E-01 -5.66E-01
Vitiligo ED63.0 Skin 2.43E-01 -9.10E-02 -8.57E-01
------------------------------------------------------------------------------------
⏷ Show the Full List of DME Expression Under 107 Diseases

References

1 Configuration of a scintillation proximity assay for the activity assessment of recombinant human adenine phosphoribosyltransferase. Assay Drug Dev Technol. 2006 Dec;4(6):661-9.