Details of Drug-Metabolizing Enzyme (DME)

General Information of Drug-Metabolizing Enzyme (DME) (ID: DE31KMQ)

DME Name Microsomal glutathione S-transferase 2 (MGST2)
Synonyms Glutathione microsomal transferase 2; Microsomal GST-2; Microsomal GST-II; MGST2
Gene Name MGST2
UniProt ID
MGST2_HUMAN
INTEDE ID
DME0089
3D Structure
Download
2D Sequence (FASTA)
Download
3D Structure (PDB)
Download
Gene ID
4258
EC Number EC: 2.5.1.18
Transferase
Alkyl/aryl transferase
Alkyl/aryl transferase
EC: 2.5.1.18
Lineage Species: Homo sapiens
Kingdom: Metazoa
Phylum: Chordata
Class: Mammalia
Order: Primates
Family: Hominidae
Genus: Homo
Species: Homo sapiens
Sequence
MAGNSILLAAVSILSACQQSYFALQVGKARLKYKVTPPAVTGSPEFERVFRAQQNCVEFY
PIFIITLWMAGWYFNQVFATCLGLVYIYGRHLYFWGYSEAAKKRITGFRLSLGILALLTL
LGALGIANSFLDEYLDLNIAKKLRRQF
Function This enzyme can catalyze the production of LTC4 from LTA4 and reduced glutathione, and it can catalyze the conjugation of 1-chloro-2,4- dinitrobenzene with reduced glutathione.
KEGG Pathway
Chemical carcinogenesis (hsa05204 )
Drug metabolism - cytochrome P450 (hsa00982 )
Drug metabolism - other enzymes (hsa00983 )
Fluid shear stress and atherosclerosis (hsa05418 )
Glutathione metabolism (hsa00480 )
Hepatocellular carcinoma (hsa05225 )
Metabolic pathways (hsa01100 )
Metabolism of xenobiotics by cytochrome P450 (hsa00980 )
Pathways in cancer (hsa05200 )
Platinum drug resistance (hsa01524 )
Reactome Pathway
Glutathione conjugation (R-HSA-156590 )
Aflatoxin activation and detoxification (R-HSA-5423646 )

Molecular Interaction Atlas (MIA) of This DME

Molecular Interaction Atlas (MIA) Jump to Detail Molecular Interaction Atlas of This DME
1 Approved Drug(s) Metabolized by This DME
Drug Name Drug ID Indication ICD 11 Highest Status REF
Busulfan DMXYJ9C Chronic myelogenous leukaemia 2A20.0 Approved [1]

Molecular Expression Atlas (MEA) of This DME

Molecular Expression Atlas (MEA) Jump to Detail Molecular Expression Atlas of This DME
Disease Name ICD 11 Studied Tissue p-value Fold-Change Z-score
Acute myelocytic leukaemia 2B33.1 Bone marrow 4.57E-07 3.08E-01 6.06E-01
Alopecia ED70 Skin from scalp 4.59E-02 1.66E-01 5.95E-01
Alzheimer's disease 8A20 Entorhinal cortex 2.31E-04 1.18E-01 4.49E-01
Ankylosing spondylitis FA92.0 Pheripheral blood 1.22E-01 1.81E-01 8.26E-01
Aortic stenosis BB70 Calcified aortic valve 3.60E-01 -2.31E-01 -2.60E-01
Apnea 7A40 Hyperplastic tonsil 4.71E-01 9.93E-01 3.63E+00
Arthropathy FA00-FA5Z Peripheral blood 6.82E-01 1.80E-01 8.14E-01
Asthma CA23 Nasal and bronchial airway 8.48E-01 2.02E-03 7.41E-03
Atopic dermatitis EA80 Skin 3.07E-02 2.17E-01 1.04E+00
Autism 6A02 Whole blood 6.30E-01 -1.44E-01 -4.80E-01
Autoimmune uveitis 9A96 Peripheral monocyte 9.85E-01 3.17E-04 6.46E-04
Autosomal dominant monocytopenia 4B04 Whole blood 4.66E-01 5.26E-02 1.71E-01
Bacterial infection of gingival 1C1H Gingival tissue 2.70E-04 -1.67E-01 -4.66E-01
Batten disease 5C56.1 Whole blood 1.92E-02 -3.48E-01 -2.21E+00
Behcet's disease 4A62 Peripheral blood 8.97E-01 -1.12E-01 -4.04E-01
Bipolar disorder 6A60-6A6Z Prefrontal cortex 3.62E-01 -7.85E-02 -4.31E-01
Bladder cancer 2C94 Bladder tissue 1.05E-02 -7.70E-01 -1.68E+00
Breast cancer 2C60-2C6Z Breast tissue 2.80E-08 -2.39E-01 -4.99E-01
Cardioembolic stroke 8B11.20 Whole blood 1.56E-07 4.82E-01 1.55E+00
Cervical cancer 2C77 Cervical tissue 3.31E-10 -5.03E-01 -2.30E+00
Childhood onset rheumatic disease FA20.Z Peripheral blood 1.94E-01 -1.01E-01 -3.22E-01
Chronic hepatitis C 1E51.1 Whole blood 6.84E-01 -3.74E-01 -5.78E-01
Chronic obstructive pulmonary disease CA22 Lung tissue 4.56E-01 -3.94E-02 -1.92E-01
Chronic obstructive pulmonary disease CA22 Small airway epithelium 2.08E-02 -1.42E-01 -4.77E-01
Chronic rhinosinusitis CA0A Sinus mucosa tissue 9.97E-01 -6.03E-02 -1.20E-01
Colon cancer 2B90 Colon tissue 8.05E-06 -1.38E-01 -5.38E-01
Coronary artery disease BA80-BA8Z Peripheral blood 5.90E-01 6.60E-01 6.75E-01
Diffuse large B-cell lymphoma 2A81 Tonsil tissue 9.40E-01 1.82E-02 2.41E-02
Endometriosis GA10 Endometrium tissue 3.78E-01 -3.70E-01 -5.60E-01
Familial hypercholesterolemia 5C80.00 Peripheral blood 3.66E-01 -8.75E-02 -2.89E-01
Familial hypercholesterolemia 5C80.00 Whole blood 5.61E-17 1.57E+00 2.15E+00
Gastric cancer 2B72 Gastric tissue 7.81E-02 6.96E-01 2.05E+00
Glioblastopma 2A00.00 Nervous tissue 4.05E-35 4.03E-01 1.02E+00
Glioma 2A00.0Y-2A00.0Z Brain stem tissue 3.86E-01 -7.30E-01 -1.05E+00
Glioma 2A00.0Y-2A00.0Z White matter tissue 3.23E-01 -7.82E-02 -6.75E-02
Head and neck cancer 2D42 Head and neck tissue 1.15E-33 -8.97E-01 -1.81E+00
HIV-associated neurocognitive impairment 8A2Y-8A2Z White matter tissue 5.54E-01 2.64E-02 7.97E-02
Huntington's disease 8A01.10 Whole blood 8.38E-01 4.36E-02 8.94E-02
Idiopathic pulmonary fibrosis CB03.4 Lung tissue 1.74E-01 2.16E-01 6.65E-01
Immunodeficiency 4A00-4A20 Peripheral blood 1.05E-02 6.12E-01 1.96E+00
Influenza 1E30 Whole blood 6.44E-01 1.42E-01 4.89E-01
Interstitial cystitis GC00.3 Bladder tissue 1.89E-05 -1.20E+00 -4.80E+00
Intracranial aneurysm 8B01.0 Intracranial artery 6.74E-02 2.20E-01 7.84E-01
Irritable bowel syndrome DD91.0 Rectal colon tissue 8.24E-02 -8.78E-02 -4.67E-01
Ischemic stroke 8B11 Peripheral blood 3.02E-01 -6.19E-02 -1.78E-01
Juvenile idiopathic arthritis FA24 Peripheral blood 5.08E-03 -2.26E-01 -6.61E-01
Lateral sclerosis 8B60.4 Skin 4.19E-01 4.96E-01 9.93E-01
Lateral sclerosis 8B60.4 Cervical spinal cord 3.22E-02 -2.53E-01 -5.58E-01
Liver cancer 2C12.0 Liver tissue 3.96E-08 -2.28E-01 -8.43E-01
Liver failure DB99.7-DB99.8 Liver tissue 1.84E-04 -1.06E+00 -4.80E+00
Lung cancer 2C25 Lung tissue 6.44E-02 -2.81E-02 -1.14E-01
Lupus erythematosus 4A40 Whole blood 2.92E-06 4.64E-01 5.93E-01
Major depressive disorder 6A70-6A7Z Hippocampus 2.88E-01 -3.62E-02 -2.07E-01
Major depressive disorder 6A70-6A7Z Whole blood 6.76E-01 -1.90E-02 -4.60E-02
Melanoma 2C30 Skin 6.23E-03 -7.27E-01 -8.28E-01
Multiple myeloma 2A83.1 Peripheral blood 7.04E-01 2.03E-01 4.48E-01
Multiple myeloma 2A83.1 Bone marrow 6.17E-08 4.15E-01 3.30E+00
Multiple sclerosis 8A40 Plasmacytoid dendritic cells 1.11E-01 -7.05E-02 -2.95E-01
Myelodysplastic syndrome 2A36-2A3Z Bone marrow 2.32E-01 -2.18E-02 -4.39E-02
Myelofibrosis 2A20.2 Whole blood 9.37E-06 1.32E-01 7.65E-01
Myocardial infarction BA41-BA50 Peripheral blood 4.46E-01 2.88E-01 4.24E-01
Myopathy 8C70.6 Muscle tissue 3.24E-01 7.29E-02 3.01E-01
Neonatal sepsis KA60 Whole blood 1.38E-19 6.24E-01 1.64E+00
Neuroectodermal tumour 2A00.11 Brain stem tissue 6.66E-01 1.08E-01 6.41E-01
Non-alcoholic fatty liver disease DB92 Liver tissue 1.37E-01 -1.38E-01 -5.62E-01
Obesity related type 2 diabetes 5A11 Omental adipose tissue 2.36E-01 2.89E-01 1.04E+00
Olive pollen allergy CA08.00 Peripheral blood 1.99E-01 8.79E-01 8.46E-01
Oral cancer 2B6E Oral tissue 4.90E-06 -5.41E-01 -1.26E+00
Osteoarthritis FA00-FA0Z Synovial tissue 4.58E-01 -1.70E-01 -2.91E-01
Osteoporosis FB83.1 Bone marrow 5.17E-02 -7.85E-01 -1.93E+00
Ovarian cancer 2C73 Ovarian tissue 4.71E-04 1.20E+00 2.13E+00
Pancreatic cancer 2C10 Pancreas 5.97E-04 5.11E-01 1.12E+00
Parkinson's disease 8A00.0 Substantia nigra tissue 6.88E-02 2.57E-01 1.04E+00
Pediatric respiratory syncytial virus infection CA40.11 Peripheral blood 2.89E-05 3.62E-01 1.18E+00
Pituitary cancer 2D12 Pituitary tissue 5.28E-01 1.56E-02 5.46E-02
Pituitary gonadotrope tumour 2D12 Pituitary tissue 8.20E-01 -1.00E-01 -3.32E-01
Polycystic ovary syndrome 5A80.1 Vastus lateralis muscle 4.12E-02 -1.06E-01 -7.65E-01
Polycythemia vera 2A20.4 Whole blood 4.96E-01 2.51E-02 1.37E-01
Pompe disease 5C51.3 Biceps muscle 5.10E-02 -1.61E-01 -8.98E-01
Preterm birth KA21.4Z Myometrium 5.98E-02 -1.93E-01 -1.85E+00
Prostate cancer 2C82 Prostate 1.33E-02 4.12E-01 8.86E-01
Psoriasis EA90 Skin 9.94E-17 2.41E-01 1.06E+00
Rectal cancer 2B92 Rectal colon tissue 3.46E-03 -5.25E-01 -2.05E+00
Renal cancer 2C90-2C91 Kidney 7.90E-01 1.00E-01 3.71E-01
Retinoblastoma 2D02.2 Uvea 3.27E-11 3.33E+00 9.72E+00
Rheumatoid arthritis FA20 Synovial tissue 8.63E-03 -3.92E-01 -8.80E-01
Rhinovirus infection CA42.1 Nasal epithelium tissue 7.13E-01 8.94E-03 8.06E-02
Schizophrenia 6A20 Prefrontal cortex 2.59E-01 -3.97E-02 -7.29E-02
Schizophrenia 6A20 Superior temporal cortex 8.86E-01 -3.45E-02 -2.36E-01
Scleroderma 4A42.Z Whole blood 1.69E-01 1.57E-01 8.44E-01
Seizure 8A60-8A6Z Whole blood 9.11E-01 9.39E-02 2.45E-01
Sensitive skin EK0Z Skin 2.36E-01 -1.53E-01 -1.26E+00
Sepsis with septic shock 1G41 Whole blood 2.26E-38 4.30E-01 1.37E+00
Shwachman-Diamond syndrome 3A70.0 Bone marrow 4.71E-03 -6.00E-01 -1.96E+00
Sickle cell disease 3A51.0-3A51.3 Peripheral blood 9.14E-02 -8.32E-02 -2.08E-01
Simpson golabi behmel syndrome LD2C Adipose tissue 6.37E-01 2.61E-02 6.10E-02
Sjogren's syndrome 4A43.2 Salivary gland tissue 1.04E-01 -3.60E-01 -1.61E+00
Skin cancer 2C30-2C3Z Skin 3.24E-55 -7.30E-01 -2.63E+00
Thrombocythemia 3B63 Whole blood 9.21E-01 -5.59E-02 -3.22E-01
Thrombocytopenia 3B64 Whole blood 6.18E-01 -3.18E-04 -5.53E-04
Thyroid cancer 2D10 Thyroid 8.66E-01 -2.07E-02 -7.89E-02
Tibial muscular dystrophy 8C75 Muscle tissue 3.53E-01 -1.30E-01 -3.68E-01
Tuberous sclerosis complex LD2D.2 Perituberal tissue 2.33E-01 3.08E-01 4.01E+00
Type 2 diabetes 5A11 Liver tissue 2.55E-01 2.21E-01 8.81E-01
Ureter cancer 2C92 Urothelium 8.15E-01 -1.80E-02 -5.29E-02
Uterine cancer 2C78 Endometrium tissue 7.90E-01 8.78E-02 1.37E-01
Vitiligo ED63.0 Skin 7.35E-01 1.01E-01 5.32E-01
------------------------------------------------------------------------------------
⏷ Show the Full List of DME Expression Under 107 Diseases

References

1 Overexpression of glutathione-S-transferase, MGSTII, confers resistance to busulfan and melphalan. Cancer Invest. 2005;23(1):19-25.