Details of Drug-Metabolizing Enzyme (DME)

General Information of Drug-Metabolizing Enzyme (DME) (ID: DE36TMY)

• DME Name: Cytochrome P450 7B1 (CYP7B1)
• Synonyms: Cytochrome P450 family 7 subfamily B member 1; 25/26-hydroxycholesterol 7-alpha-hydroxylase; 3-hydroxysteroid 7-alpha hydroxylase; CYP7B1
• Gene Name: CYP7B1
• UniProt ID: CP7B1_HUMAN
• INTEDE ID: DME0608
• Gene ID: 9420
• EC Number:
  EC: 1.14.14.29
  Oxidoreductase
  Oxygen paired donor oxidoreductase
  Flavin/flavoprotein donor oxidoreductase
  EC: 1.14.14.29
• Lineage:
  Species: Homo sapiens
  Kingdom: Metazoa
  Phylum: Chordata
  Class: Mammalia
  Order: Primates
  Family: Hominidae
  Genus: Homo
  Species: Homo sapiens
• Sequence:
  MAGEVSAATGRFSLERLGLPGLALAAALLLLALCLLVRRTRRPGEPPLIKGWLPYLGVVL
  NLRKDPLRFMKTLQKQHGDTFTVLLGGKYITFILDPFQYQLVIKNHKQLSFRVFSNKLLE
  KAFSISQLQKNHDMNDELHLCYQFLQGKSLDILLESMMQNLKQVFEPQLLKTTSWDTAEL
  YPFCSSIIFEITFTTIYGKVIVCDNNKFISELRDDFLKFDDKFAYLVSNIPIELLGNVKS
  IREKIIKCFSSEKLAKMQGWSEVFQSRQDVLEKYYVHEDLEIGAHHLGFLWASVANTIPT
  MFWAMYYLLRHPEAMAAVRDEIDRLLQSTGQKKGSGFPIHLTREQLDSLICLESSIFEAL
  RLSSYSTTIRFVEEDLTLSSETGDYCVRKGDLVAIFPPVLHGDPEIFEAPEEFRYDRFIE
  DGKKKTTFFKRGKKLKCYLMPFGTGTSKCPGRFFALMEIKQLLVILLTYFDLEIIDDKPI
  GLNYSRLLFGIQYPDSDVLFRYKVKS
• Function: This enzyme involves in the metabolism of endogenous oxysterols and steroid hormones, including neurosteroids.
• KEGG Pathway:
  Primary bile acid biosynthesis (hsa00120)
  Steroid hormone biosynthesis (hsa00140)
• Reactome Pathway:
  Endogenous sterols (R-HSA-211976)
  Synthesis of bile acids and bile salts via 27-hydroxycholesterol (R-HSA-193807)
  Synthesis of bile acids and bile salts via 7alpha-hydroxycholesterol (R-HSA-193368)
  Synthesis of bile acids and bile salts (R-HSA-192105)
  Defective CYP7B1 causes Spastic paraplegia 5A, autosomal recessive (SPG5A) and Congenital bile acid synthesis defect 3 (CBAS3) (R-HSA-5579013)

Molecular Interaction Atlas (MIA) of This DME

1 Approved Drug(s) Metabolized by This DME

Drug Name	Drug ID	Indication	ICD 11	Highest Status	REF
Prasterone	DM67VKL	Chronic obstructive pulmonary disease	CA22	Approved	[1]

1 Investigative Drug(s) Metabolized by This DME

Drug Name	Drug ID	Indication	ICD 11	Highest Status	REF
Hombreol	DMZYB3S	N. A.	N. A.	Investigative	[1]

Molecular Expression Atlas (MEA) of This DME

Disease Name	ICD 11	Studied Tissue	p-value	Fold-Change	Z-score
Acute myelocytic leukaemia	2B33.1	Bone marrow	1.07E-24	1.76E-01	1.40E+00
Alzheimer's disease	8A20	Entorhinal cortex	1.92E-01	-1.05E-01	-2.46E-01
Asthma	CA23	Nasal and bronchial airway	8.36E-02	-7.34E-02	-1.01E-01
Behcet's disease	4A62	Peripheral blood	5.60E-01	-1.20E-01	-5.25E-01
Bipolar disorder	6A60-6A6Z	Prefrontal cortex	9.40E-01	4.16E-04	1.57E-03
Bladder cancer	2C94	Bladder tissue	6.23E-01	-5.75E-02	-3.97E-01
Breast cancer	2C60-2C6Z	Breast tissue	1.67E-05	-2.84E-01	-6.38E-01
Colon cancer	2B90	Colon tissue	1.15E-08	9.51E-02	4.55E-01
Diffuse large B-cell lymphoma	2A81	Tonsil tissue	7.10E-01	4.49E-02	2.70E-01
Familial hypercholesterolemia	5C80.00	Peripheral blood	6.63E-02	9.35E-02	8.61E-01
Gastric cancer	2B72	Gastric tissue	3.26E-01	1.17E-01	4.56E-01
Glioblastopma	2A00.00	Nervous tissue	6.87E-17	-1.42E-01	-3.24E-01
Head and neck cancer	2D42	Head and neck tissue	1.27E-01	6.26E-02	1.52E-01
HIV-associated neurocognitive impairment	8A2Y-8A2Z	White matter tissue	6.37E-01	-2.12E-01	-6.01E-01
Idiopathic pulmonary fibrosis	CB03.4	Lung tissue	3.54E-01	-6.01E-03	-7.63E-03
Interstitial cystitis	GC00.3	Bladder tissue	2.94E-02	2.97E-01	1.40E+00
Ischemic stroke	8B11	Peripheral blood	9.46E-01	-5.20E-03	-3.03E-02
Liver cancer	2C12.0	Liver tissue	1.78E-13	-6.78E-01	-1.37E+00
Liver failure	DB99.7-DB99.8	Liver tissue	1.57E-07	-1.90E+00	-4.66E+00
Lung cancer	2C25	Lung tissue	1.40E-30	3.70E-01	9.43E-01
Lupus erythematosus	4A40	Whole blood	1.54E-03	2.21E-02	1.27E-01
Major depressive disorder	6A70-6A7Z	Hippocampus	5.88E-01	1.68E-02	7.00E-02
Multiple myeloma	2A83.1	Bone marrow	2.81E-03	-5.05E-01	-1.74E+00
Multiple myeloma	2A83.1	Peripheral blood	1.23E-01	1.08E-01	9.67E-01
Multiple sclerosis	8A40	Plasmacytoid dendritic cells	6.18E-01	-1.41E-02	-7.46E-02
Myelodysplastic syndrome	2A36-2A3Z	Bone marrow	1.72E-08	3.01E-01	1.11E+00
Myocardial infarction	BA41-BA50	Peripheral blood	3.72E-01	3.16E-04	3.73E-04
Neuroectodermal tumour	2A00.11	Brain stem tissue	8.61E-01	-5.50E-02	-3.13E-01
Non-alcoholic fatty liver disease	DB92	Liver tissue	4.44E-03	-3.98E-01	-1.27E+00
Obesity related type 2 diabetes	5A11	Omental adipose tissue	7.37E-01	-5.05E-02	-2.88E-01
Olive pollen allergy	CA08.00	Peripheral blood	1.91E-01	-8.22E-02	-6.30E-01
Oral cancer	2B6E	Oral tissue	1.31E-02	2.02E-01	4.10E-01
Ovarian cancer	2C73	Ovarian tissue	5.52E-01	-1.33E-01	-3.82E-01
Pancreatic cancer	2C10	Pancreas	3.79E-03	-5.72E-01	-1.04E+00
Parkinson's disease	8A00.0	Substantia nigra tissue	3.07E-01	-8.64E-02	-3.70E-01
Pituitary cancer	2D12	Pituitary tissue	7.86E-01	1.08E-02	4.02E-02
Polycystic ovary syndrome	5A80.1	Vastus lateralis muscle	8.58E-01	-7.09E-02	-5.97E-01
Pompe disease	5C51.3	Biceps muscle	8.44E-01	1.15E-02	5.27E-02
Prostate cancer	2C82	Prostate	3.45E-04	1.08E+00	1.26E+00
Psoriasis	EA90	Skin	7.17E-34	1.22E+00	3.04E+00
Rectal cancer	2B92	Rectal colon tissue	1.38E-01	1.75E-01	8.79E-01
Renal cancer	2C90-2C91	Kidney	1.13E-01	2.52E-02	8.23E-02
Retinoblastoma	2D02.2	Uvea	3.05E-01	7.87E-02	7.21E-01
Schizophrenia	6A20	Prefrontal cortex	6.56E-02	9.58E-04	3.56E-03
Schizophrenia	6A20	Superior temporal cortex	2.40E-01	2.84E-02	1.49E-01
Scleroderma	4A42.Z	Whole blood	1.34E-01	4.93E-02	5.31E-01
Seizure	8A60-8A6Z	Whole blood	9.12E-01	1.17E-02	1.04E-01
Sepsis with septic shock	1G41	Whole blood	1.68E-05	8.65E-02	3.84E-01
Sickle cell disease	3A51.0-3A51.3	Peripheral blood	6.86E-01	-1.56E-02	-8.66E-02
Simpson golabi behmel syndrome	LD2C	Adipose tissue	3.39E-01	-5.11E-02	-1.44E+00
Sjogren's syndrome	4A43.2	Salivary gland tissue	9.09E-02	2.56E-01	2.00E+00
Skin cancer	2C30-2C3Z	Skin	4.06E-40	8.02E-01	1.89E+00
Thrombocythemia	3B63	Whole blood	1.53E-02	7.54E-02	5.79E-01
Thrombocytopenia	3B64	Whole blood	9.62E-01	5.94E-02	3.66E-01
Thyroid cancer	2D10	Thyroid	1.22E-41	-1.04E+00	-2.45E+00
Tibial muscular dystrophy	8C75	Muscle tissue	7.78E-02	6.64E-02	8.61E-01
Tuberous sclerosis complex	LD2D.2	Perituberal tissue	3.19E-02	1.81E-01	6.94E+00
Type 2 diabetes	5A11	Liver tissue	6.00E-01	5.07E-02	1.74E-01
Ureter cancer	2C92	Urothelium	5.84E-01	-2.64E-03	-2.35E-02
Uterine cancer	2C78	Endometrium tissue	3.41E-02	6.50E-02	1.09E-01
Vitiligo	ED63.0	Skin	1.50E-01	-8.91E-02	-4.49E-01

References

• [1] CYP7B1-mediated metabolism of dehydroepiandrosterone and 5alpha-androstane-3beta,17beta-diol--potential role(s) for estrogen signaling. FEBS J. 2008 Apr;275(8):1778-89.