Details of Drug-Metabolizing Enzyme (DME)

General Information of Drug-Metabolizing Enzyme (DME) (ID: DE3OP9S)

DME Name Galactose kinase (GALK1)
Synonyms Galactokinase; ATP:D-galactose-1-phosphotransferase; BiGalK; GALK; GALK1; CLB.507001.110; CLB.510667.120
Gene Name GALK1
UniProt ID
GALK1_HUMAN
INTEDE ID
DME0417
3D Structure
Download
2D Sequence (FASTA)
Download
3D Structure (PDB)
Download
Gene ID
2584
EC Number EC: 2.7.1.6
Transferase
Kinase
Phosphotransferase
EC: 2.7.1.6
Lineage Species: Homo sapiens
Kingdom: Metazoa
Phylum: Chordata
Class: Mammalia
Order: Primates
Family: Hominidae
Genus: Homo
Species: Homo sapiens
Sequence
MAALRQPQVAELLAEARRAFREEFGAEPELAVSAPGRVNLIGEHTDYNQGLVLPMALELM
TVLVGSPRKDGLVSLLTTSEGADEPQRLQFPLPTAQRSLEPGTPRWANYVKGVIQYYPAA
PLPGFSAVVVSSVPLGGGLSSSASLEVATYTFLQQLCPDSGTIAARAQVCQQAEHSFAGM
PCGIMDQFISLMGQKGHALLIDCRSLETSLVPLSDPKLAVLITNSNVRHSLASSEYPVRR
RQCEEVARALGKESLREVQLEELEAARDLVSKEGFRRARHVVGEIRRTAQAAAALRRGDY
RAFGRLMVESHRSLRDDYEVSCPELDQLVEAALAVPGVYGSRMTGGGFGGCTVTLLEASA
APHAMRHIQEHYGGTATFYLSQAADGAKVLCL
Function This enzyme is important for galactose metabolism.
KEGG Pathway
Amino sugar and nucleotide sugar metabolism (hsa00520 )
Galactose metabolism (hsa00052 )
Metabolic pathways (hsa01100 )
Reactome Pathway
Galactose catabolism (R-HSA-70370 )
Defective GALK1 can cause Galactosemia II (GALCT2) (R-HSA-5609976 )

Molecular Interaction Atlas (MIA) of This DME

Molecular Interaction Atlas (MIA) Jump to Detail Molecular Interaction Atlas of This DME
1 Clinical Trial Drug(s) Metabolized by This DME
Drug Name Drug ID Indication ICD 11 Highest Status REF
CERC-801 DM3SZ7P N. A. N. A. Phase 2 [1]

Molecular Expression Atlas (MEA) of This DME

Molecular Expression Atlas (MEA) Jump to Detail Molecular Expression Atlas of This DME
Disease Name ICD 11 Studied Tissue p-value Fold-Change Z-score
Acute myelocytic leukaemia 2B33.1 Bone marrow 2.54E-17 3.17E-01 1.25E+00
Alopecia ED70 Skin from scalp 4.52E-01 6.79E-02 1.99E-01
Alzheimer's disease 8A20 Entorhinal cortex 9.90E-01 1.86E-02 1.14E-01
Ankylosing spondylitis FA92.0 Pheripheral blood 1.35E-01 1.02E-01 6.45E-01
Aortic stenosis BB70 Calcified aortic valve 8.67E-01 -2.60E-02 -7.04E-02
Apnea 7A40 Hyperplastic tonsil 1.71E-01 -5.95E-02 -3.84E-01
Arthropathy FA00-FA5Z Peripheral blood 6.82E-01 1.39E-02 9.57E-02
Asthma CA23 Nasal and bronchial airway 1.51E-03 3.96E-01 6.39E-01
Atopic dermatitis EA80 Skin 4.25E-03 1.15E-01 6.66E-01
Autism 6A02 Whole blood 7.13E-01 -6.65E-02 -2.28E-01
Autoimmune uveitis 9A96 Peripheral monocyte 4.21E-02 -2.93E-01 -2.04E+00
Autosomal dominant monocytopenia 4B04 Whole blood 1.95E-01 -2.90E-01 -1.24E+00
Bacterial infection of gingival 1C1H Gingival tissue 6.39E-01 -7.12E-03 -2.84E-02
Batten disease 5C56.1 Whole blood 3.08E-01 1.16E-01 9.91E-01
Behcet's disease 4A62 Peripheral blood 3.86E-01 1.44E-01 7.60E-01
Bipolar disorder 6A60-6A6Z Prefrontal cortex 6.81E-01 -4.13E-02 -2.97E-01
Bladder cancer 2C94 Bladder tissue 2.96E-01 -2.92E-02 -1.32E-01
Breast cancer 2C60-2C6Z Breast tissue 9.31E-14 1.15E-01 4.79E-01
Cardioembolic stroke 8B11.20 Whole blood 7.80E-01 3.30E-02 1.39E-01
Cervical cancer 2C77 Cervical tissue 4.60E-01 -1.23E-01 -4.24E-01
Childhood onset rheumatic disease FA20.Z Peripheral blood 3.80E-01 -3.06E-02 -9.96E-02
Chronic hepatitis C 1E51.1 Whole blood 8.44E-02 8.40E-02 1.00E+00
Chronic obstructive pulmonary disease CA22 Lung tissue 5.47E-01 -2.57E-02 -1.34E-01
Chronic obstructive pulmonary disease CA22 Small airway epithelium 1.06E-02 1.40E-01 6.22E-01
Chronic rhinosinusitis CA0A Sinus mucosa tissue 6.63E-01 5.55E-02 4.46E-01
Colon cancer 2B90 Colon tissue 1.18E-20 2.26E-01 1.06E+00
Coronary artery disease BA80-BA8Z Peripheral blood 1.67E-02 -1.89E-01 -2.06E+00
Diffuse large B-cell lymphoma 2A81 Tonsil tissue 6.62E-01 4.29E-02 1.53E-01
Endometriosis GA10 Endometrium tissue 1.00E+00 -6.43E-02 -1.62E-01
Familial hypercholesterolemia 5C80.00 Peripheral blood 9.12E-01 -3.05E-02 -2.36E-01
Familial hypercholesterolemia 5C80.00 Whole blood 3.10E-03 2.11E-01 8.97E-01
Gastric cancer 2B72 Gastric tissue 2.21E-01 2.36E-01 1.37E+00
Glioblastopma 2A00.00 Nervous tissue 2.72E-06 6.13E-02 2.87E-01
Glioma 2A00.0Y-2A00.0Z Brain stem tissue 9.54E-01 -4.56E-02 -1.72E-01
Glioma 2A00.0Y-2A00.0Z White matter tissue 4.81E-04 -3.09E-01 -1.47E+00
Head and neck cancer 2D42 Head and neck tissue 6.35E-04 1.33E-01 3.99E-01
HIV-associated neurocognitive impairment 8A2Y-8A2Z White matter tissue 2.99E-01 -6.41E-02 -6.86E-01
Huntington's disease 8A01.10 Whole blood 1.77E-01 3.10E-02 1.52E-01
Idiopathic pulmonary fibrosis CB03.4 Lung tissue 5.67E-01 -8.67E-03 -4.95E-02
Immunodeficiency 4A00-4A20 Peripheral blood 8.90E-02 1.10E-01 1.49E+00
Influenza 1E30 Whole blood 8.57E-02 2.23E-01 1.33E+00
Interstitial cystitis GC00.3 Bladder tissue 1.90E-01 1.78E-01 9.74E-01
Intracranial aneurysm 8B01.0 Intracranial artery 8.86E-03 1.30E-01 9.86E-01
Irritable bowel syndrome DD91.0 Rectal colon tissue 5.92E-01 1.07E-02 5.94E-02
Ischemic stroke 8B11 Peripheral blood 7.41E-01 2.05E-04 1.62E-03
Juvenile idiopathic arthritis FA24 Peripheral blood 8.82E-01 9.09E-03 1.93E-02
Lateral sclerosis 8B60.4 Skin 9.27E-01 1.10E-01 4.72E-01
Lateral sclerosis 8B60.4 Cervical spinal cord 9.52E-01 6.36E-02 3.52E-01
Liver cancer 2C12.0 Liver tissue 4.52E-02 -2.44E-01 -4.37E-01
Liver failure DB99.7-DB99.8 Liver tissue 1.44E-01 -8.61E-02 -2.21E-01
Lung cancer 2C25 Lung tissue 3.21E-02 -5.23E-02 -2.24E-01
Lupus erythematosus 4A40 Whole blood 3.25E-10 3.41E-01 7.07E-01
Major depressive disorder 6A70-6A7Z Hippocampus 4.20E-01 2.84E-02 1.99E-01
Major depressive disorder 6A70-6A7Z Whole blood 2.83E-01 4.12E-02 1.05E-01
Melanoma 2C30 Skin 3.51E-01 5.19E-02 9.06E-02
Multiple myeloma 2A83.1 Peripheral blood 5.66E-01 -2.34E-01 -5.69E-01
Multiple myeloma 2A83.1 Bone marrow 1.27E-02 2.25E-01 1.06E+00
Multiple sclerosis 8A40 Plasmacytoid dendritic cells 3.28E-01 -1.23E-01 -6.45E-01
Myelodysplastic syndrome 2A36-2A3Z Bone marrow 4.57E-02 -5.71E-02 -3.46E-01
Myelofibrosis 2A20.2 Whole blood 5.85E-01 -9.42E-02 -7.07E-01
Myocardial infarction BA41-BA50 Peripheral blood 5.02E-01 -5.63E-03 -1.59E-02
Myopathy 8C70.6 Muscle tissue 9.87E-01 -9.44E-04 -9.31E-03
Neonatal sepsis KA60 Whole blood 1.89E-07 1.78E-01 7.32E-01
Neuroectodermal tumour 2A00.11 Brain stem tissue 1.56E-01 -1.31E-01 -7.42E-01
Non-alcoholic fatty liver disease DB92 Liver tissue 7.44E-02 3.97E-01 9.99E-01
Obesity related type 2 diabetes 5A11 Omental adipose tissue 8.35E-01 -3.86E-02 -4.05E-01
Olive pollen allergy CA08.00 Peripheral blood 1.90E-01 1.84E-01 7.26E-01
Oral cancer 2B6E Oral tissue 5.17E-06 -3.95E-01 -1.24E+00
Osteoarthritis FA00-FA0Z Synovial tissue 5.49E-01 -3.61E-01 -9.79E-01
Osteoporosis FB83.1 Bone marrow 2.11E-02 3.30E-01 1.68E+00
Ovarian cancer 2C73 Ovarian tissue 2.14E-02 2.79E-01 1.11E+00
Pancreatic cancer 2C10 Pancreas 4.67E-01 -1.13E-01 -2.58E-01
Parkinson's disease 8A00.0 Substantia nigra tissue 8.93E-01 6.15E-02 3.31E-01
Pediatric respiratory syncytial virus infection CA40.11 Peripheral blood 3.28E-03 1.24E-01 8.00E-01
Pituitary cancer 2D12 Pituitary tissue 2.37E-04 3.03E-01 1.90E+00
Pituitary gonadotrope tumour 2D12 Pituitary tissue 1.91E-01 1.12E-01 6.31E-01
Polycystic ovary syndrome 5A80.1 Vastus lateralis muscle 6.47E-01 2.65E-02 1.24E-01
Polycythemia vera 2A20.4 Whole blood 2.77E-01 -3.22E-02 -2.32E-01
Pompe disease 5C51.3 Biceps muscle 1.36E-03 4.38E-01 2.25E+00
Preterm birth KA21.4Z Myometrium 9.60E-01 -1.18E-01 -1.27E+00
Prostate cancer 2C82 Prostate 1.02E-01 4.27E-01 6.96E-01
Psoriasis EA90 Skin 4.14E-22 3.07E-01 1.17E+00
Rectal cancer 2B92 Rectal colon tissue 1.33E-01 -6.17E-02 -2.17E-01
Renal cancer 2C90-2C91 Kidney 2.88E-02 -2.43E-01 -7.22E-01
Retinoblastoma 2D02.2 Uvea 8.47E-04 4.34E-01 2.40E+00
Rheumatoid arthritis FA20 Synovial tissue 8.85E-01 1.08E-01 3.00E-01
Rhinovirus infection CA42.1 Nasal epithelium tissue 9.80E-01 3.36E-02 2.30E-01
Schizophrenia 6A20 Prefrontal cortex 5.17E-02 1.44E-01 3.18E-01
Schizophrenia 6A20 Superior temporal cortex 2.80E-01 2.63E-02 2.43E-01
Scleroderma 4A42.Z Whole blood 1.47E-02 -1.47E-01 -1.00E+00
Seizure 8A60-8A6Z Whole blood 3.84E-01 9.41E-02 4.08E-01
Sensitive skin EK0Z Skin 7.73E-01 -1.13E-01 -5.92E-01
Sepsis with septic shock 1G41 Whole blood 1.61E-22 2.71E-01 1.07E+00
Shwachman-Diamond syndrome 3A70.0 Bone marrow 1.39E-01 1.40E-01 1.18E+00
Sickle cell disease 3A51.0-3A51.3 Peripheral blood 3.00E-01 4.66E-02 3.79E-01
Simpson golabi behmel syndrome LD2C Adipose tissue 8.99E-01 1.04E-01 3.40E-01
Sjogren's syndrome 4A43.2 Salivary gland tissue 6.31E-01 -1.24E-01 -3.63E-01
Skin cancer 2C30-2C3Z Skin 2.37E-09 1.23E-01 3.19E-01
Thrombocythemia 3B63 Whole blood 8.86E-04 -7.28E-02 -5.55E-01
Thrombocytopenia 3B64 Whole blood 5.46E-01 5.56E-01 5.73E-01
Thyroid cancer 2D10 Thyroid 2.36E-05 8.32E-02 4.09E-01
Tibial muscular dystrophy 8C75 Muscle tissue 1.63E-04 -2.04E-01 -1.59E+00
Tuberous sclerosis complex LD2D.2 Perituberal tissue 9.97E-01 -4.03E-02 -1.71E-01
Type 2 diabetes 5A11 Liver tissue 4.66E-02 -5.24E-01 -1.29E+00
Ureter cancer 2C92 Urothelium 7.99E-01 -1.78E-02 -1.24E-01
Uterine cancer 2C78 Endometrium tissue 9.49E-08 -2.08E-01 -4.74E-01
Vitiligo ED63.0 Skin 7.20E-02 -1.45E-01 -1.04E+00
------------------------------------------------------------------------------------
⏷ Show the Full List of DME Expression Under 107 Diseases

References

1 Molecular and biochemical characterization of human galactokinase and its small molecule inhibitors. Chem Biol Interact. 2010 Dec 5;188(3):376-85.