Details of Drug-Metabolizing Enzyme (DME)

General Information of Drug-Metabolizing Enzyme (DME) (ID: DE3OZT4)

DME Name Testicular acid phosphatase (ACP4)
Synonyms Acid monophosphatase 4; Acid nucleoside diphosphate phosphatase 4; Acid phosphatase 4; ACP4; ACPT
Gene Name ACP4
UniProt ID
PPAT_HUMAN
INTEDE ID
DME0229
3D Structure
Download
2D Sequence (FASTA)
Download
3D Structure (PDB)
Download
Gene ID
93650
EC Number EC: 3.1.3.2
Hydrolases
Ester bond hydrolase
Phosphoric monoester hydrolase
EC: 3.1.3.2
Lineage Species: Homo sapiens
Kingdom: Metazoa
Phylum: Chordata
Class: Mammalia
Order: Primates
Family: Hominidae
Genus: Homo
Species: Homo sapiens
Sequence
MAGLGFWGHPAGPLLLLLLLVLPPRALPEGPLVFVALVFRHGDRAPLASYPMDPHKEVAS
TLWPRGLGQLTTEGVRQQLELGRFLRSRYEAFLSPEYRREEVYIRSTDFDRTLESAQANL
AGLFPEAAPGSPEARWRPIPVHTVPVAEDKLLRFPMRSCPRYHELLREATEAAEYQEALE
GWTGFLSRLENFTGLSLVGEPLRRAWKVLDTLMCQQAHGLPLPAWASPDVLRTLAQISAL
DIGAHVGPPRAAEKAQLTGGILLNAILANFSRVQRLGLPLKMVMYSAHDSTLLALQGALG
LYDGHTPPYAACLGFEFRKHLGNPAKDGGNVTVSLFYRNDSAHLPLPLSLPGCPAPCPLG
RFYQLTAPARPPAHGVSCHGPYEAAIPPAPVVPLLAGAVAVLVALSLGLGLLAWRPGCLR
ALGGPV
Function This enzyme dephosphorylates receptor tyrosine-protein kinase ERBB4 and inhibits its ligand-induced proteolytic cleavage. And it may play a role in odontogenesis.

Molecular Interaction Atlas (MIA) of This DME

Molecular Interaction Atlas (MIA) Jump to Detail Molecular Interaction Atlas of This DME
1 Approved Drug(s) Metabolized by This DME
Drug Name Drug ID Indication ICD 11 Highest Status REF
Riboflavin DM8YMWE Acne vulgaris ED80 Approved [1]

Molecular Expression Atlas (MEA) of This DME

Molecular Expression Atlas (MEA) Jump to Detail Molecular Expression Atlas of This DME
Disease Name ICD 11 Studied Tissue p-value Fold-Change Z-score
Acute myelocytic leukaemia 2B33.1 Bone marrow 3.46E-01 2.40E-02 7.18E-02
Alopecia ED70 Skin from scalp 1.40E-02 -1.43E-01 -3.70E-01
Alzheimer's disease 8A20 Entorhinal cortex 2.63E-02 -5.57E-02 -3.23E-01
Ankylosing spondylitis FA92.0 Pheripheral blood 6.77E-01 -7.62E-02 -6.10E-01
Aortic stenosis BB70 Calcified aortic valve 8.59E-01 -9.29E-03 -8.47E-03
Apnea 7A40 Hyperplastic tonsil 3.88E-01 -1.87E-01 -6.71E-01
Arthropathy FA00-FA5Z Peripheral blood 2.09E-01 5.58E-02 2.42E-01
Asthma CA23 Nasal and bronchial airway 4.69E-08 -3.44E-01 -4.08E-01
Atopic dermatitis EA80 Skin 1.71E-02 8.58E-02 6.39E-01
Autism 6A02 Whole blood 1.51E-02 -1.89E-01 -6.16E-01
Autoimmune uveitis 9A96 Peripheral monocyte 1.88E-01 -6.03E-02 -4.15E-01
Autosomal dominant monocytopenia 4B04 Whole blood 7.63E-01 1.70E-02 6.34E-02
Bacterial infection of gingival 1C1H Gingival tissue 2.71E-02 -1.25E-01 -3.58E-01
Batten disease 5C56.1 Whole blood 2.49E-01 9.05E-02 6.27E-01
Behcet's disease 4A62 Peripheral blood 4.71E-01 2.92E-02 1.48E-01
Bipolar disorder 6A60-6A6Z Prefrontal cortex 6.44E-01 2.62E-02 9.83E-02
Bladder cancer 2C94 Bladder tissue 4.72E-01 9.77E-03 7.62E-02
Breast cancer 2C60-2C6Z Breast tissue 3.32E-15 1.46E-01 4.86E-01
Cardioembolic stroke 8B11.20 Whole blood 7.81E-01 3.62E-02 1.72E-01
Cervical cancer 2C77 Cervical tissue 1.06E-02 -3.88E-02 -3.89E-01
Childhood onset rheumatic disease FA20.Z Peripheral blood 4.86E-01 1.60E-01 4.83E-01
Chronic hepatitis C 1E51.1 Whole blood 8.50E-02 2.29E-01 1.09E+00
Chronic obstructive pulmonary disease CA22 Lung tissue 7.45E-01 1.09E-01 3.62E-01
Chronic obstructive pulmonary disease CA22 Small airway epithelium 1.93E-01 3.93E-03 1.19E-02
Chronic rhinosinusitis CA0A Sinus mucosa tissue 6.65E-01 -8.71E-02 -3.57E-01
Colon cancer 2B90 Colon tissue 5.20E-05 1.52E-01 4.49E-01
Coronary artery disease BA80-BA8Z Peripheral blood 6.98E-01 -3.48E-03 -3.13E-02
Diffuse large B-cell lymphoma 2A81 Tonsil tissue 5.66E-01 -1.38E-01 -3.87E-01
Endometriosis GA10 Endometrium tissue 1.41E-01 -7.50E-02 -1.80E-01
Familial hypercholesterolemia 5C80.00 Peripheral blood 5.26E-01 -1.95E-02 -9.18E-02
Familial hypercholesterolemia 5C80.00 Whole blood 6.28E-05 -7.26E-01 -1.52E+00
Gastric cancer 2B72 Gastric tissue 2.65E-01 -7.10E-01 -1.15E+00
Glioblastopma 2A00.00 Nervous tissue 3.90E-14 1.82E-01 6.66E-01
Glioma 2A00.0Y-2A00.0Z Brain stem tissue 3.15E-01 -3.40E-01 -1.33E+00
Glioma 2A00.0Y-2A00.0Z White matter tissue 2.02E-09 -9.94E-01 -6.45E+00
Head and neck cancer 2D42 Head and neck tissue 1.96E-03 1.07E-01 3.87E-01
HIV-associated neurocognitive impairment 8A2Y-8A2Z White matter tissue 6.67E-02 1.50E-01 7.21E-01
Huntington's disease 8A01.10 Whole blood 8.79E-02 1.09E-01 4.23E-01
Idiopathic pulmonary fibrosis CB03.4 Lung tissue 4.20E-01 -2.75E-02 -1.34E-01
Immunodeficiency 4A00-4A20 Peripheral blood 7.35E-01 3.18E-02 1.96E-01
Influenza 1E30 Whole blood 4.40E-02 2.47E-01 2.21E+00
Interstitial cystitis GC00.3 Bladder tissue 2.72E-02 1.63E-01 1.84E+00
Intracranial aneurysm 8B01.0 Intracranial artery 2.76E-01 2.99E-01 8.87E-01
Irritable bowel syndrome DD91.0 Rectal colon tissue 5.84E-01 4.87E-02 2.63E-01
Ischemic stroke 8B11 Peripheral blood 4.08E-01 5.03E-03 2.62E-02
Juvenile idiopathic arthritis FA24 Peripheral blood 5.33E-01 1.18E-01 3.04E-01
Lateral sclerosis 8B60.4 Skin 7.16E-02 2.47E-01 1.30E+00
Lateral sclerosis 8B60.4 Cervical spinal cord 7.80E-01 9.84E-02 1.69E-01
Liver cancer 2C12.0 Liver tissue 3.92E-24 -7.42E-01 -2.90E+00
Liver failure DB99.7-DB99.8 Liver tissue 1.10E-05 -8.12E-01 -4.59E+00
Lung cancer 2C25 Lung tissue 6.51E-01 -2.72E-02 -9.39E-02
Lupus erythematosus 4A40 Whole blood 4.26E-02 -2.40E-01 -3.58E-01
Major depressive disorder 6A70-6A7Z Hippocampus 5.31E-01 1.28E-01 4.81E-01
Major depressive disorder 6A70-6A7Z Whole blood 8.79E-01 -2.37E-02 -9.36E-02
Melanoma 2C30 Skin 3.33E-02 -1.55E-01 -3.77E-01
Multiple myeloma 2A83.1 Peripheral blood 2.10E-01 -2.10E-01 -8.29E-01
Multiple myeloma 2A83.1 Bone marrow 2.09E-02 -2.84E-01 -9.44E-01
Multiple sclerosis 8A40 Plasmacytoid dendritic cells 2.06E-01 3.99E-01 1.11E+00
Myelodysplastic syndrome 2A36-2A3Z Bone marrow 3.58E-01 -1.08E-01 -3.90E-01
Myelofibrosis 2A20.2 Whole blood 7.73E-01 4.02E-02 2.50E-01
Myocardial infarction BA41-BA50 Peripheral blood 1.52E-02 4.15E-01 7.12E-01
Myopathy 8C70.6 Muscle tissue 9.57E-02 -3.48E-01 -1.13E+00
Neonatal sepsis KA60 Whole blood 1.98E-05 -2.69E-01 -7.67E-01
Neuroectodermal tumour 2A00.11 Brain stem tissue 2.46E-04 4.30E-01 1.86E+00
Non-alcoholic fatty liver disease DB92 Liver tissue 7.56E-01 -2.14E-01 -7.48E-01
Obesity related type 2 diabetes 5A11 Omental adipose tissue 3.92E-01 8.27E-02 9.75E-01
Olive pollen allergy CA08.00 Peripheral blood 5.57E-01 -3.12E-03 -1.08E-02
Oral cancer 2B6E Oral tissue 1.22E-01 2.00E-01 5.43E-01
Osteoarthritis FA00-FA0Z Synovial tissue 7.42E-01 -4.75E-02 -1.69E-01
Osteoporosis FB83.1 Bone marrow 1.88E-02 3.13E-01 2.30E+00
Ovarian cancer 2C73 Ovarian tissue 8.24E-01 3.01E-02 1.10E-01
Pancreatic cancer 2C10 Pancreas 1.48E-01 -8.02E-02 -2.19E-01
Parkinson's disease 8A00.0 Substantia nigra tissue 7.96E-01 -1.39E-02 -8.70E-02
Pediatric respiratory syncytial virus infection CA40.11 Peripheral blood 6.18E-01 -7.35E-02 -3.56E-01
Pituitary cancer 2D12 Pituitary tissue 9.84E-01 1.56E-03 5.18E-03
Pituitary gonadotrope tumour 2D12 Pituitary tissue 7.95E-01 -3.17E-03 -1.19E-02
Polycystic ovary syndrome 5A80.1 Vastus lateralis muscle 8.67E-02 2.34E-01 7.55E-01
Polycythemia vera 2A20.4 Whole blood 5.06E-01 5.15E-02 2.90E-01
Pompe disease 5C51.3 Biceps muscle 5.19E-02 -1.79E-01 -1.10E+00
Preterm birth KA21.4Z Myometrium 1.99E-01 -1.38E-01 -5.28E-01
Prostate cancer 2C82 Prostate 1.38E-01 3.29E-01 5.67E-01
Psoriasis EA90 Skin 8.25E-01 1.43E-02 4.62E-02
Rectal cancer 2B92 Rectal colon tissue 5.94E-02 -2.87E-01 -1.21E+00
Renal cancer 2C90-2C91 Kidney 4.50E-06 3.81E-01 2.62E+00
Retinoblastoma 2D02.2 Uvea 6.61E-01 8.46E-03 5.49E-02
Rheumatoid arthritis FA20 Synovial tissue 3.55E-02 -5.85E-01 -1.38E+00
Rhinovirus infection CA42.1 Nasal epithelium tissue 3.58E-01 -1.55E-02 -8.00E-02
Schizophrenia 6A20 Prefrontal cortex 8.64E-01 -3.60E-02 -9.84E-02
Schizophrenia 6A20 Superior temporal cortex 6.42E-01 1.53E-02 1.44E-01
Scleroderma 4A42.Z Whole blood 5.45E-06 6.87E-01 2.97E+00
Seizure 8A60-8A6Z Whole blood 6.06E-01 -5.33E-02 -3.61E-01
Sensitive skin EK0Z Skin 8.29E-01 -7.96E-02 -2.78E-01
Sepsis with septic shock 1G41 Whole blood 1.42E-02 5.38E-03 1.90E-02
Shwachman-Diamond syndrome 3A70.0 Bone marrow 1.83E-01 3.81E-01 1.06E+00
Sickle cell disease 3A51.0-3A51.3 Peripheral blood 6.80E-01 1.58E-01 8.45E-01
Simpson golabi behmel syndrome LD2C Adipose tissue 7.38E-01 1.20E-01 6.84E-01
Sjogren's syndrome 4A43.2 Salivary gland tissue 1.53E-01 -9.10E-01 -1.76E+00
Skin cancer 2C30-2C3Z Skin 2.37E-03 -2.07E-01 -6.48E-01
Thrombocythemia 3B63 Whole blood 8.09E-01 3.80E-02 2.28E-01
Thrombocytopenia 3B64 Whole blood 2.58E-01 1.16E-01 2.45E-01
Thyroid cancer 2D10 Thyroid 9.46E-01 3.68E-02 1.34E-01
Tibial muscular dystrophy 8C75 Muscle tissue 3.43E-04 -3.08E-01 -1.61E+00
Tuberous sclerosis complex LD2D.2 Perituberal tissue 5.73E-02 3.84E-01 3.45E+00
Type 2 diabetes 5A11 Liver tissue 5.82E-01 1.77E-01 4.61E-01
Ureter cancer 2C92 Urothelium 9.69E-01 -1.52E-01 -4.38E-01
Uterine cancer 2C78 Endometrium tissue 3.09E-12 -3.44E-01 -8.05E-01
Vitiligo ED63.0 Skin 5.87E-01 -6.82E-02 -5.62E-01
------------------------------------------------------------------------------------
⏷ Show the Full List of DME Expression Under 107 Diseases

References

1 An atlas of human metabolism. Sci Signal. 2020 Mar 24;13(624). pii: eaaz1482. (Reaction HMR_6507)