Details of Drug-Metabolizing Enzyme (DME)

General Information of Drug-Metabolizing Enzyme (DME) (ID: DE4A3BL)

DME Name Diaphorase-1 (CYB5R3)
Synonyms Cytochrome b5 reductase; NADH-cytochrome b5 reductase 3; NADH-cytochrome b5 reductase 3 membrane-bound form; NADH-cytochrome b5 reductase 3 soluble form; B5R; CYB5R3; DIA1
Gene Name CYB5R3
UniProt ID
NB5R3_HUMAN
INTEDE ID
DME0473
3D Structure
Download
2D Sequence (FASTA)
Download
3D Structure (PDB)
Download
Gene ID
1727
EC Number EC: 1.6.2.2
Oxidoreductase
NADH/NADPH oxidoreductase
Heme protein acceptor oxidoreductase
EC: 1.6.2.2
Lineage Species: Homo sapiens
Kingdom: Metazoa
Phylum: Chordata
Class: Mammalia
Order: Primates
Family: Hominidae
Genus: Homo
Species: Homo sapiens
Sequence
MGAQLSTLGHMVLFPVWFLYSLLMKLFQRSTPAITLESPDIKYPLRLIDREIISHDTRRF
RFALPSPQHILGLPVGQHIYLSARIDGNLVVRPYTPISSDDDKGFVDLVIKVYFKDTHPK
FPAGGKMSQYLESMQIGDTIEFRGPSGLLVYQGKGKFAIRPDKKSNPIIRTVKSVGMIAG
GTGITPMLQVIRAIMKDPDDHTVCHLLFANQTEKDILLRPELEELRNKHSARFKLWYTLD
RAPEAWDYGQGFVNEEMIRDHLPPPEEEPLVLMCGPPPMIQYACLPNLDHVGHPTERCFV
F
Function This enzyme is involved in desaturation and elongation of fatty acids, cholesterol biosynthesis, drug metabolism, and, in erythrocyte, methemoglobin reduction.
KEGG Pathway
Amino sugar and nucleotide sugar metabolism (hsa00520 )
Reactome Pathway
Phase I - Functionalization of compounds (R-HSA-211945 )
Vitamin C (ascorbate) metabolism (R-HSA-196836 )
Neutrophil degranulation (R-HSA-6798695 )

Molecular Interaction Atlas (MIA) of This DME

Molecular Interaction Atlas (MIA) Jump to Detail Molecular Interaction Atlas of This DME
1 Approved Drug(s) Metabolized by This DME
Drug Name Drug ID Indication ICD 11 Highest Status REF
NADH DM5NM6E Parkinson disease 8A00.0 Approved [1]
1 Investigative Drug(s) Metabolized by This DME
Drug Name Drug ID Indication ICD 11 Highest Status REF
Ferricyanide DM1TH08 N. A. N. A. Investigative [1]
Experimental Enzyme Kinetic Data of Drugs
Drug Name Indication Highest Status Kinetic Data REF
NADH Parkinson disease [8A00.0] Approved Km = 0.006 microM [1]

Molecular Expression Atlas (MEA) of This DME

Molecular Expression Atlas (MEA) Jump to Detail Molecular Expression Atlas of This DME
Disease Name ICD 11 Studied Tissue p-value Fold-Change Z-score
Acute myelocytic leukaemia 2B33.1 Bone marrow 3.57E-06 2.00E-01 4.93E-01
Alopecia ED70 Skin from scalp 5.18E-01 -1.47E-03 -4.45E-03
Alzheimer's disease 8A20 Entorhinal cortex 6.14E-01 3.33E-02 1.32E-01
Ankylosing spondylitis FA92.0 Pheripheral blood 2.80E-01 2.66E-01 1.13E+00
Aortic stenosis BB70 Calcified aortic valve 4.60E-01 2.70E-02 1.08E-01
Apnea 7A40 Hyperplastic tonsil 3.42E-02 -4.66E-01 -5.25E+00
Arthropathy FA00-FA5Z Peripheral blood 6.17E-01 -3.57E-04 -1.20E-03
Asthma CA23 Nasal and bronchial airway 8.33E-03 -1.42E-01 -2.96E-01
Atopic dermatitis EA80 Skin 5.81E-01 -3.18E-01 -5.22E-01
Autism 6A02 Whole blood 1.10E-01 -1.45E-01 -4.06E-01
Autoimmune uveitis 9A96 Peripheral monocyte 1.84E-01 -1.39E-01 -6.84E-01
Autosomal dominant monocytopenia 4B04 Whole blood 3.38E-01 3.13E-01 1.48E+00
Bacterial infection of gingival 1C1H Gingival tissue 3.64E-02 1.04E-01 2.83E-01
Batten disease 5C56.1 Whole blood 7.29E-01 -1.05E-01 -2.57E-01
Behcet's disease 4A62 Peripheral blood 8.23E-01 -3.44E-02 -1.07E-01
Bipolar disorder 6A60-6A6Z Prefrontal cortex 5.32E-01 -4.53E-02 -2.21E-01
Bladder cancer 2C94 Bladder tissue 1.94E-04 -9.32E-01 -2.66E+00
Breast cancer 2C60-2C6Z Breast tissue 3.45E-11 -4.24E-01 -5.61E-01
Cardioembolic stroke 8B11.20 Whole blood 1.12E-13 -7.07E-01 -3.01E+00
Cervical cancer 2C77 Cervical tissue 2.10E-02 4.73E-02 1.86E-01
Childhood onset rheumatic disease FA20.Z Peripheral blood 9.19E-02 9.12E-02 2.30E-01
Chronic hepatitis C 1E51.1 Whole blood 2.29E-01 -8.60E-02 -7.42E-01
Chronic obstructive pulmonary disease CA22 Lung tissue 2.17E-01 -2.48E-01 -5.03E-01
Chronic obstructive pulmonary disease CA22 Small airway epithelium 5.83E-01 -1.34E-01 -3.21E-01
Chronic rhinosinusitis CA0A Sinus mucosa tissue 1.76E-01 1.37E-01 5.25E-01
Colon cancer 2B90 Colon tissue 3.90E-17 -2.17E-01 -6.88E-01
Coronary artery disease BA80-BA8Z Peripheral blood 6.27E-01 7.57E-02 2.36E-01
Diffuse large B-cell lymphoma 2A81 Tonsil tissue 8.97E-01 4.61E-03 2.68E-02
Endometriosis GA10 Endometrium tissue 5.27E-01 1.28E-01 3.07E-01
Familial hypercholesterolemia 5C80.00 Peripheral blood 6.49E-01 -2.13E-01 -1.19E+00
Familial hypercholesterolemia 5C80.00 Whole blood 7.49E-03 3.42E-01 1.19E+00
Gastric cancer 2B72 Gastric tissue 5.28E-01 -1.62E-01 -2.02E-01
Glioblastopma 2A00.00 Nervous tissue 9.77E-16 -4.81E-01 -6.87E-01
Glioma 2A00.0Y-2A00.0Z Brain stem tissue 3.61E-01 1.54E-01 7.93E-01
Glioma 2A00.0Y-2A00.0Z White matter tissue 7.10E-03 3.73E-01 8.70E-01
Head and neck cancer 2D42 Head and neck tissue 3.21E-01 -2.83E-02 -6.77E-02
HIV-associated neurocognitive impairment 8A2Y-8A2Z White matter tissue 8.98E-03 3.43E-01 1.22E+00
Huntington's disease 8A01.10 Whole blood 2.92E-02 1.40E-01 7.22E-01
Idiopathic pulmonary fibrosis CB03.4 Lung tissue 9.68E-02 5.02E-01 2.28E+00
Immunodeficiency 4A00-4A20 Peripheral blood 6.07E-01 4.56E-05 4.42E-04
Influenza 1E30 Whole blood 1.91E-01 -5.13E-01 -9.96E-01
Interstitial cystitis GC00.3 Bladder tissue 5.93E-02 -3.56E-01 -1.24E+00
Intracranial aneurysm 8B01.0 Intracranial artery 5.90E-01 1.89E-01 4.80E-01
Irritable bowel syndrome DD91.0 Rectal colon tissue 4.90E-02 -4.82E-01 -9.34E-01
Ischemic stroke 8B11 Peripheral blood 8.31E-01 -3.82E-02 -1.35E-01
Juvenile idiopathic arthritis FA24 Peripheral blood 4.34E-01 -1.23E-02 -2.41E-02
Lateral sclerosis 8B60.4 Skin 1.06E-01 -1.56E-01 -4.67E-01
Lateral sclerosis 8B60.4 Cervical spinal cord 5.01E-01 1.21E-01 4.17E-01
Liver cancer 2C12.0 Liver tissue 9.61E-01 -5.31E-02 -7.72E-02
Liver failure DB99.7-DB99.8 Liver tissue 6.06E-01 6.34E-02 2.06E-01
Lung cancer 2C25 Lung tissue 2.22E-36 -1.00E+00 -1.35E+00
Lupus erythematosus 4A40 Whole blood 2.42E-01 -7.74E-02 -2.71E-01
Major depressive disorder 6A70-6A7Z Hippocampus 2.06E-01 -6.31E-02 -3.15E-01
Major depressive disorder 6A70-6A7Z Whole blood 1.14E-01 8.13E-02 2.61E-01
Melanoma 2C30 Skin 7.34E-01 3.80E-01 2.57E-01
Multiple myeloma 2A83.1 Peripheral blood 6.82E-01 4.41E-03 2.15E-02
Multiple myeloma 2A83.1 Bone marrow 3.57E-01 7.67E-03 3.31E-02
Multiple sclerosis 8A40 Plasmacytoid dendritic cells 3.31E-01 -9.44E-02 -8.60E-01
Myelodysplastic syndrome 2A36-2A3Z Bone marrow 2.22E-03 1.76E-01 9.69E-01
Myelofibrosis 2A20.2 Whole blood 9.71E-01 -1.97E-02 -1.01E-01
Myocardial infarction BA41-BA50 Peripheral blood 5.18E-01 2.64E-01 3.22E-01
Myopathy 8C70.6 Muscle tissue 9.50E-05 4.73E-01 2.26E+00
Neonatal sepsis KA60 Whole blood 9.54E-27 1.01E+00 1.96E+00
Neuroectodermal tumour 2A00.11 Brain stem tissue 1.85E-21 -1.80E+00 -1.25E+01
Non-alcoholic fatty liver disease DB92 Liver tissue 9.96E-01 -1.48E-01 -4.75E-01
Obesity related type 2 diabetes 5A11 Omental adipose tissue 9.02E-02 1.99E-01 6.85E-01
Olive pollen allergy CA08.00 Peripheral blood 5.77E-01 6.90E-02 2.91E-01
Oral cancer 2B6E Oral tissue 4.67E-01 -3.57E-02 -6.07E-02
Osteoarthritis FA00-FA0Z Synovial tissue 2.89E-01 8.17E-01 5.74E-01
Osteoporosis FB83.1 Bone marrow 5.88E-02 2.98E-01 1.77E+00
Ovarian cancer 2C73 Ovarian tissue 1.09E-02 -6.65E-01 -1.02E+00
Pancreatic cancer 2C10 Pancreas 4.16E-04 8.41E-01 1.19E+00
Parkinson's disease 8A00.0 Substantia nigra tissue 2.72E-03 -2.89E-01 -9.61E-01
Pediatric respiratory syncytial virus infection CA40.11 Peripheral blood 3.19E-03 2.30E-01 9.78E-01
Pituitary cancer 2D12 Pituitary tissue 4.07E-01 1.11E-01 3.50E-01
Pituitary gonadotrope tumour 2D12 Pituitary tissue 6.93E-01 1.16E-01 3.53E-01
Polycystic ovary syndrome 5A80.1 Vastus lateralis muscle 1.99E-01 3.18E-03 3.23E-02
Polycythemia vera 2A20.4 Whole blood 2.61E-03 -7.80E-02 -3.76E-01
Pompe disease 5C51.3 Biceps muscle 2.38E-04 6.84E-01 4.49E+00
Preterm birth KA21.4Z Myometrium 8.28E-01 3.83E-02 5.61E-02
Prostate cancer 2C82 Prostate 6.95E-08 -1.28E+00 -1.96E+00
Psoriasis EA90 Skin 2.14E-19 -1.17E+00 -1.84E+00
Rectal cancer 2B92 Rectal colon tissue 1.03E-01 -1.28E-01 -7.42E-01
Renal cancer 2C90-2C91 Kidney 2.92E-01 1.28E-01 2.42E-01
Retinoblastoma 2D02.2 Uvea 4.58E-01 -1.83E-01 -6.21E-01
Rheumatoid arthritis FA20 Synovial tissue 1.55E-10 2.14E+00 9.63E+00
Rhinovirus infection CA42.1 Nasal epithelium tissue 4.09E-01 -1.77E-02 -1.07E-01
Schizophrenia 6A20 Prefrontal cortex 1.44E-01 -5.85E-02 -2.36E-01
Schizophrenia 6A20 Superior temporal cortex 7.77E-01 1.86E-02 1.04E-01
Scleroderma 4A42.Z Whole blood 3.38E-06 -5.72E-01 -2.89E+00
Seizure 8A60-8A6Z Whole blood 3.09E-02 -3.70E-01 -1.44E+00
Sensitive skin EK0Z Skin 7.28E-01 2.96E-03 1.28E-02
Sepsis with septic shock 1G41 Whole blood 1.97E-27 6.46E-01 1.24E+00
Shwachman-Diamond syndrome 3A70.0 Bone marrow 8.57E-01 7.81E-02 5.87E-01
Sickle cell disease 3A51.0-3A51.3 Peripheral blood 2.13E-03 2.72E-01 1.17E+00
Simpson golabi behmel syndrome LD2C Adipose tissue 6.80E-01 7.02E-02 7.34E-01
Sjogren's syndrome 4A43.2 Salivary gland tissue 4.89E-01 1.87E-01 5.61E-01
Skin cancer 2C30-2C3Z Skin 1.74E-14 -7.68E-01 -9.81E-01
Thrombocythemia 3B63 Whole blood 1.98E-02 -1.30E-01 -6.35E-01
Thrombocytopenia 3B64 Whole blood 6.36E-01 3.40E-01 2.96E-01
Thyroid cancer 2D10 Thyroid 6.05E-08 -4.39E-01 -7.23E-01
Tibial muscular dystrophy 8C75 Muscle tissue 4.34E-03 7.24E-01 8.85E-01
Tuberous sclerosis complex LD2D.2 Perituberal tissue 8.90E-01 2.55E-01 1.20E+00
Type 2 diabetes 5A11 Liver tissue 8.46E-01 1.40E-01 5.05E-01
Ureter cancer 2C92 Urothelium 3.34E-01 1.11E-02 4.08E-02
Uterine cancer 2C78 Endometrium tissue 4.50E-24 -1.21E+00 -1.56E+00
Vitiligo ED63.0 Skin 2.47E-01 -1.37E-01 -7.75E-01
------------------------------------------------------------------------------------
⏷ Show the Full List of DME Expression Under 107 Diseases

References

1 Expression of a novel P275L variant of NADH:cytochrome b5 reductase gives functional insight into the conserved motif important for pyridine nucleotide binding. Arch Biochem Biophys. 2006 Mar 1;447(1):59-67.