Details of Drug-Metabolizing Enzyme (DME)
General Information of Drug-Metabolizing Enzyme (DME) (ID: DE4AMLP)
DME Name | Nicotinate dehydrogenase (nicA) | ||||
---|---|---|---|---|---|
Synonyms | Nicotinate degradation protein A; Nicotinate dehydrogenase small subunit; PP_3947; ndhS; nicA | ||||
Gene Name | nicA | ||||
UniProt ID | |||||
INTEDE ID | |||||
3D Structure | |||||
Gene ID | |||||
EC Number | EC: 1.17.2.1 | ||||
Lineage | Species: Pseudomonas putida | ||||
Tissue Distribution | Primarily distributed in human gut. | ||||
Sequence |
MQTTISLQVNGQPVEVSAMPDTPLLLILRNDLCLNGPKYGCGLGECGACTVIIDGVAARS
CVIPLAGAAGRNITTLEGLGSKAAPHPVQQAFIDEQAAQCGYCMNGMIMTAKALLDRIPE PSDEQIRNELSANLCRCGTHVEILRAVRRAAETRRKP |
||||
Function |
This enzyme is subunit of the two-component enzyme NicAB that mediates nicotinate hydroxylation, the first step in the aerobic nicotinate degradation pathway. And it mediates conversion of nicotinate into 6-hydroxynicotinate (6HNA).
|
||||
KEGG Pathway | |||||
Molecular Interaction Atlas (MIA) of This DME
Molecular Interaction Atlas (MIA) | ||||||||||||||||||||||||||||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
1 Approved Drug(s) Metabolized by This DME
|
||||||||||||||||||||||||||||
Experimental Enzyme Kinetic Data of Drugs |
|
|||||||||||||||||||||||||||