Details of Drug-Metabolizing Enzyme (DME)

General Information of Drug-Metabolizing Enzyme (DME) (ID: DE4E31Z)

DME Name Deoxy-5'-nucleotidase 1 (NT5C)
Synonyms Cytosolic 5'(3')-deoxyribonucleotidase; Cytosolic 5',3'-pyrimidine nucleotidase; DNT1; NT5C; UMPH2; dNT-1
Gene Name NT5C
UniProt ID
NT5C_HUMAN
INTEDE ID
DME0150
3D Structure
Download
2D Sequence (FASTA)
Download
3D Structure (PDB)
Download
Gene ID
30833
EC Number EC: 3.1.3.5
Hydrolases
Ester bond hydrolase
Phosphoric monoester hydrolase
EC: 3.1.3.5
Lineage Species: Homo sapiens
Kingdom: Metazoa
Phylum: Chordata
Class: Mammalia
Order: Primates
Family: Hominidae
Genus: Homo
Species: Homo sapiens
Sequence
MARSVRVLVDMDGVLADFEAGLLRGFRRRFPEEPHVPLEQRRGFLAREQYRALRPDLADK
VASVYEAPGFFLDLEPIPGALDAVREMNDLPDTQVFICTSPLLKYHHCVGEKYRWVEQHL
GPQFVERIILTRDKTVVLGDLLIDDKDTVRGQEETPSWEHILFTCCHNRHLVLPPTRRRL
LSWSDNWREILDSKRGAAQRE
Function This enzyme dephosphorylates the 5' and 2'(3')-phosphates of deoxyribonucleotides, with a preference for dUMP and dTMP, intermediate activity towards dGMP, and low activity towards dCMP and dAMP.
KEGG Pathway
Metabolic pathways (hsa01100 )
Nicotinate and nicotinamide metabolism (hsa00760 )
Purine metabolism (hsa00230 )
Pyrimidine metabolism (hsa00240 )
Reactome Pathway
Pyrimidine catabolism (R-HSA-73621 )
Purine catabolism (R-HSA-74259 )

Molecular Interaction Atlas (MIA) of This DME

Molecular Interaction Atlas (MIA) Jump to Detail Molecular Interaction Atlas of This DME
1 Approved Drug(s) Metabolized by This DME
Drug Name Drug ID Indication ICD 11 Highest Status REF
Lamivudine DMI347A Chronic HBV infection 1E51.0Z Approved [1]

Molecular Expression Atlas (MEA) of This DME

Molecular Expression Atlas (MEA) Jump to Detail Molecular Expression Atlas of This DME
Disease Name ICD 11 Studied Tissue p-value Fold-Change Z-score
Acute myelocytic leukaemia 2B33.1 Bone marrow 6.22E-38 3.47E-01 1.71E+00
Alopecia ED70 Skin from scalp 6.39E-02 -1.62E-01 -5.32E-01
Alzheimer's disease 8A20 Entorhinal cortex 2.93E-02 4.83E-02 3.71E-01
Ankylosing spondylitis FA92.0 Pheripheral blood 7.57E-01 2.30E-03 1.54E-02
Aortic stenosis BB70 Calcified aortic valve 8.26E-01 4.59E-02 7.81E-02
Apnea 7A40 Hyperplastic tonsil 3.76E-01 -1.44E-02 -7.15E-02
Arthropathy FA00-FA5Z Peripheral blood 2.45E-01 -4.11E-02 -2.40E-01
Asthma CA23 Nasal and bronchial airway 2.97E-01 5.52E-02 8.53E-02
Atopic dermatitis EA80 Skin 2.25E-13 5.04E-01 2.72E+00
Autism 6A02 Whole blood 5.73E-01 -3.20E-03 -1.56E-02
Autoimmune uveitis 9A96 Peripheral monocyte 8.23E-01 -4.65E-02 -2.00E-01
Autosomal dominant monocytopenia 4B04 Whole blood 2.09E-01 -1.36E-01 -9.66E-01
Bacterial infection of gingival 1C1H Gingival tissue 4.42E-01 -3.41E-02 -1.27E-01
Batten disease 5C56.1 Whole blood 2.89E-01 5.35E-02 7.27E-01
Behcet's disease 4A62 Peripheral blood 7.13E-01 1.68E-02 5.42E-02
Bipolar disorder 6A60-6A6Z Prefrontal cortex 2.74E-01 -4.49E-02 -2.43E-01
Bladder cancer 2C94 Bladder tissue 2.10E-03 3.45E-01 1.52E+00
Breast cancer 2C60-2C6Z Breast tissue 2.15E-68 3.41E-01 1.29E+00
Cardioembolic stroke 8B11.20 Whole blood 1.17E-06 -5.08E-01 -1.55E+00
Cervical cancer 2C77 Cervical tissue 3.44E-01 5.45E-02 2.42E-01
Childhood onset rheumatic disease FA20.Z Peripheral blood 5.12E-01 2.59E-02 7.21E-02
Chronic hepatitis C 1E51.1 Whole blood 5.11E-01 -1.13E-01 -3.50E-01
Chronic obstructive pulmonary disease CA22 Lung tissue 8.97E-01 -3.24E-02 -1.48E-01
Chronic obstructive pulmonary disease CA22 Small airway epithelium 3.70E-01 -6.99E-02 -2.75E-01
Chronic rhinosinusitis CA0A Sinus mucosa tissue 3.11E-01 1.23E-01 7.00E-01
Colon cancer 2B90 Colon tissue 7.04E-07 -2.34E-01 -6.47E-01
Coronary artery disease BA80-BA8Z Peripheral blood 3.05E-01 -2.16E-01 -7.38E-01
Diffuse large B-cell lymphoma 2A81 Tonsil tissue 3.01E-01 1.24E-01 8.19E-01
Endometriosis GA10 Endometrium tissue 6.24E-01 2.56E-02 8.63E-02
Familial hypercholesterolemia 5C80.00 Peripheral blood 7.48E-01 -1.71E-02 -8.71E-02
Familial hypercholesterolemia 5C80.00 Whole blood 4.58E-02 -2.43E-01 -1.06E+00
Gastric cancer 2B72 Gastric tissue 7.57E-01 -2.09E-01 -6.14E-01
Glioblastopma 2A00.00 Nervous tissue 2.08E-43 2.22E-01 8.07E-01
Glioma 2A00.0Y-2A00.0Z Brain stem tissue 5.84E-01 1.37E-01 5.09E-01
Glioma 2A00.0Y-2A00.0Z White matter tissue 2.48E-01 1.03E-01 3.35E-01
Head and neck cancer 2D42 Head and neck tissue 3.67E-04 -1.54E-01 -5.77E-01
HIV-associated neurocognitive impairment 8A2Y-8A2Z White matter tissue 2.95E-01 -3.96E-03 -2.36E-02
Huntington's disease 8A01.10 Whole blood 2.14E-01 1.07E-01 9.13E-01
Idiopathic pulmonary fibrosis CB03.4 Lung tissue 1.94E-01 1.72E-01 9.64E-01
Immunodeficiency 4A00-4A20 Peripheral blood 9.20E-01 -3.33E-02 -3.13E-01
Influenza 1E30 Whole blood 3.36E-01 -1.12E-01 -2.44E-01
Interstitial cystitis GC00.3 Bladder tissue 6.62E-01 1.67E-01 7.27E-01
Intracranial aneurysm 8B01.0 Intracranial artery 7.88E-02 1.27E-01 8.84E-01
Irritable bowel syndrome DD91.0 Rectal colon tissue 1.54E-01 -1.32E-01 -2.96E-01
Ischemic stroke 8B11 Peripheral blood 2.31E-01 -3.21E-02 -1.74E-01
Juvenile idiopathic arthritis FA24 Peripheral blood 1.51E-03 -2.77E-01 -6.74E-01
Lateral sclerosis 8B60.4 Skin 5.60E-01 -1.77E-01 -6.61E-01
Lateral sclerosis 8B60.4 Cervical spinal cord 5.85E-01 -3.15E-02 -1.25E-01
Liver cancer 2C12.0 Liver tissue 8.00E-07 1.62E-01 6.87E-01
Liver failure DB99.7-DB99.8 Liver tissue 3.39E-02 1.85E-01 9.79E-01
Lung cancer 2C25 Lung tissue 2.87E-42 2.96E-01 1.20E+00
Lupus erythematosus 4A40 Whole blood 7.08E-02 8.71E-02 3.03E-01
Major depressive disorder 6A70-6A7Z Hippocampus 6.69E-01 -1.22E-02 -6.71E-02
Major depressive disorder 6A70-6A7Z Whole blood 8.35E-01 -1.26E-02 -4.35E-02
Melanoma 2C30 Skin 8.76E-05 3.72E-01 9.42E-01
Multiple myeloma 2A83.1 Peripheral blood 4.27E-01 1.85E-01 5.78E-01
Multiple myeloma 2A83.1 Bone marrow 1.35E-03 -4.47E-01 -1.96E+00
Multiple sclerosis 8A40 Plasmacytoid dendritic cells 3.45E-01 4.51E-01 9.80E-01
Myelodysplastic syndrome 2A36-2A3Z Bone marrow 9.40E-01 2.21E-03 1.02E-02
Myelofibrosis 2A20.2 Whole blood 9.84E-01 -2.24E-02 -1.87E-01
Myocardial infarction BA41-BA50 Peripheral blood 5.62E-01 -1.96E-01 -3.40E-01
Myopathy 8C70.6 Muscle tissue 3.32E-01 1.76E-03 1.72E-02
Neonatal sepsis KA60 Whole blood 8.62E-01 -7.18E-03 -3.37E-02
Neuroectodermal tumour 2A00.11 Brain stem tissue 3.84E-06 5.47E-01 2.73E+00
Non-alcoholic fatty liver disease DB92 Liver tissue 3.51E-01 -2.77E-03 -1.72E-02
Obesity related type 2 diabetes 5A11 Omental adipose tissue 7.99E-01 5.95E-02 6.58E-01
Olive pollen allergy CA08.00 Peripheral blood 2.04E-01 2.07E-01 8.86E-01
Oral cancer 2B6E Oral tissue 1.32E-02 -1.90E-01 -4.41E-01
Osteoarthritis FA00-FA0Z Synovial tissue 4.85E-01 -1.57E-01 -3.49E-01
Osteoporosis FB83.1 Bone marrow 8.45E-03 3.02E-01 2.41E+00
Ovarian cancer 2C73 Ovarian tissue 5.95E-01 7.89E-03 2.64E-02
Pancreatic cancer 2C10 Pancreas 2.62E-01 1.14E-02 2.97E-02
Parkinson's disease 8A00.0 Substantia nigra tissue 5.62E-01 -5.31E-02 -2.57E-01
Pediatric respiratory syncytial virus infection CA40.11 Peripheral blood 4.28E-01 1.12E-02 5.97E-02
Pituitary cancer 2D12 Pituitary tissue 8.27E-01 0.00E+00 0.00E+00
Pituitary gonadotrope tumour 2D12 Pituitary tissue 9.22E-01 2.03E-02 1.52E-01
Polycystic ovary syndrome 5A80.1 Vastus lateralis muscle 5.06E-01 1.30E-01 6.58E-01
Polycythemia vera 2A20.4 Whole blood 1.36E-04 -9.60E-02 -7.05E-01
Pompe disease 5C51.3 Biceps muscle 4.38E-02 -1.11E-01 -7.86E-01
Preterm birth KA21.4Z Myometrium 7.49E-01 3.14E-02 2.93E-01
Prostate cancer 2C82 Prostate 4.41E-04 -5.08E-01 -9.49E-01
Psoriasis EA90 Skin 2.23E-02 9.69E-02 3.39E-01
Rectal cancer 2B92 Rectal colon tissue 7.38E-01 -6.93E-03 -3.12E-02
Renal cancer 2C90-2C91 Kidney 5.29E-06 3.07E-01 2.21E+00
Retinoblastoma 2D02.2 Uvea 1.87E-01 1.34E-01 6.08E-01
Rheumatoid arthritis FA20 Synovial tissue 7.73E-03 2.87E-01 1.11E+00
Rhinovirus infection CA42.1 Nasal epithelium tissue 1.72E-01 -1.99E-02 -1.57E-01
Schizophrenia 6A20 Prefrontal cortex 2.38E-01 3.93E-02 1.12E-01
Schizophrenia 6A20 Superior temporal cortex 3.47E-01 -2.34E-02 -2.25E-01
Scleroderma 4A42.Z Whole blood 3.84E-06 -3.66E-01 -3.01E+00
Seizure 8A60-8A6Z Whole blood 3.37E-02 2.16E-01 1.34E+00
Sensitive skin EK0Z Skin 1.17E-01 8.82E-02 6.06E-01
Sepsis with septic shock 1G41 Whole blood 6.01E-01 1.81E-02 1.01E-01
Shwachman-Diamond syndrome 3A70.0 Bone marrow 1.36E-01 2.10E-01 1.11E+00
Sickle cell disease 3A51.0-3A51.3 Peripheral blood 1.56E-01 4.96E-02 2.72E-01
Simpson golabi behmel syndrome LD2C Adipose tissue 6.80E-01 -2.14E-02 -1.09E-01
Sjogren's syndrome 4A43.2 Salivary gland tissue 1.39E-01 -1.52E-01 -7.85E-01
Skin cancer 2C30-2C3Z Skin 4.12E-19 4.13E-01 1.28E+00
Thrombocythemia 3B63 Whole blood 7.28E-03 -9.30E-02 -7.77E-01
Thrombocytopenia 3B64 Whole blood 4.66E-01 3.47E-01 4.00E-01
Thyroid cancer 2D10 Thyroid 1.72E-02 1.06E-02 5.77E-02
Tibial muscular dystrophy 8C75 Muscle tissue 9.89E-02 -1.28E-01 -6.50E-01
Tuberous sclerosis complex LD2D.2 Perituberal tissue 5.06E-01 6.57E-02 3.99E-01
Type 2 diabetes 5A11 Liver tissue 6.94E-02 -2.17E-01 -8.49E-01
Ureter cancer 2C92 Urothelium 9.07E-01 2.83E-02 1.40E-01
Uterine cancer 2C78 Endometrium tissue 2.48E-11 -2.33E-01 -4.27E-01
Vitiligo ED63.0 Skin 5.77E-01 -7.01E-02 -5.37E-01
------------------------------------------------------------------------------------
⏷ Show the Full List of DME Expression Under 107 Diseases

References

1 Nucleoside and nucleotide HIV reverse transcriptase inhibitors: 25 years after zidovudine. Antiviral Res. 2010 Jan;85(1):39-58.