Details of Drug-Metabolizing Enzyme (DME)

General Information of Drug-Metabolizing Enzyme (DME) (ID: DE4Q2OE)

DME Name Prostaglandin reductase 1 (PTGR1)
Synonyms NADP-dependent leukotriene B4 12-hydroxydehydrogenase; 15-oxoprostaglandin 13-reductase; LTB4DH; PRG-1; PTGR1
Gene Name PTGR1
UniProt ID
PTGR1_HUMAN
INTEDE ID
DME0429
3D Structure
Download
2D Sequence (FASTA)
Download
3D Structure (PDB)
Download
Gene ID
22949
EC Number EC: 1.3.1.16
Oxidoreductase
CH-CH donor oxidoreductase
NAD/NADP acceptor oxidoreductase
EC: 1.3.1.16
Lineage Species: Homo sapiens
Kingdom: Metazoa
Phylum: Chordata
Class: Mammalia
Order: Primates
Family: Hominidae
Genus: Homo
Species: Homo sapiens
Sequence
MVRTKTWTLKKHFVGYPTNSDFELKTAELPPLKNGEVLLEALFLTVDPYMRVAAKRLKEG
DTMMGQQVAKVVESKNVALPKGTIVLASPGWTTHSISDGKDLEKLLTEWPDTIPLSLALG
TVGMPGLTAYFGLLEICGVKGGETVMVNAAAGAVGSVVGQIAKLKGCKVVGAVGSDEKVA
YLQKLGFDVVFNYKTVESLEETLKKASPDGYDCYFDNVGGEFSNTVIGQMKKFGRIAICG
AISTYNRTGPLPPGPPPEIVIYQELRMEAFVVYRWQGDARQKALKDLLKWVLEGKIQYKE
YIIEGFENMPAAFMGMLKGDNLGKTIVKA
Function
This enzyme functions as 15-oxo-prostaglandin 13-reductase and acts on 15-oxo-PGE1, 15-oxo-PGE2 and 15-oxo-PGE2-alpha. It catalyzes the conversion of leukotriene B4 into its biologically less active metabolite, 12-oxo- leukotriene B4, which is an initial and key step of metabolic inactivation of leukotriene B4.
Reactome Pathway
Synthesis of Lipoxins (LX) (R-HSA-2142700 )
Synthesis of Leukotrienes (LT) and Eoxins (EX) (R-HSA-2142691 )

Molecular Interaction Atlas (MIA) of This DME

Molecular Interaction Atlas (MIA) Jump to Detail Molecular Interaction Atlas of This DME
1 Clinical Trial Drug(s) Metabolized by This DME
Drug Name Drug ID Indication ICD 11 Highest Status REF
MGI-114 DMNYPW7 N. A. N. A. Phase 2 [1]

Molecular Expression Atlas (MEA) of This DME

Molecular Expression Atlas (MEA) Jump to Detail Molecular Expression Atlas of This DME
Disease Name ICD 11 Studied Tissue p-value Fold-Change Z-score
Acute myelocytic leukaemia 2B33.1 Bone marrow 3.15E-01 -2.21E-01 -4.19E-01
Alopecia ED70 Skin from scalp 1.40E-01 -1.69E-01 -3.44E-01
Alzheimer's disease 8A20 Entorhinal cortex 2.99E-04 -2.20E-01 -4.04E-01
Ankylosing spondylitis FA92.0 Pheripheral blood 1.55E-01 2.27E-01 7.15E-01
Aortic stenosis BB70 Calcified aortic valve 9.65E-01 -6.61E-02 -2.91E-01
Apnea 7A40 Hyperplastic tonsil 1.67E-01 -1.13E+00 -1.76E+00
Arthropathy FA00-FA5Z Peripheral blood 3.15E-01 9.61E-03 6.63E-02
Asthma CA23 Nasal and bronchial airway 3.30E-02 1.71E-01 2.44E-01
Atopic dermatitis EA80 Skin 2.31E-01 -7.15E-02 -1.32E-01
Autism 6A02 Whole blood 3.18E-01 -1.25E-02 -6.70E-02
Autoimmune uveitis 9A96 Peripheral monocyte 8.49E-02 -7.80E-02 -5.22E-01
Autosomal dominant monocytopenia 4B04 Whole blood 1.78E-03 5.50E-01 3.02E+00
Bacterial infection of gingival 1C1H Gingival tissue 5.19E-06 -4.58E-01 -6.40E-01
Batten disease 5C56.1 Whole blood 7.90E-01 -8.91E-03 -4.55E-02
Behcet's disease 4A62 Peripheral blood 2.33E-01 2.18E-01 9.21E-01
Bipolar disorder 6A60-6A6Z Prefrontal cortex 2.17E-01 -5.63E-02 -1.08E-01
Bladder cancer 2C94 Bladder tissue 7.01E-06 -2.49E+00 -4.15E+00
Breast cancer 2C60-2C6Z Breast tissue 1.14E-04 3.14E-01 4.58E-01
Cardioembolic stroke 8B11.20 Whole blood 4.87E-01 4.65E-02 1.76E-01
Cervical cancer 2C77 Cervical tissue 9.64E-02 -4.16E-01 -5.96E-01
Childhood onset rheumatic disease FA20.Z Peripheral blood 5.58E-01 2.70E-02 1.58E-01
Chronic hepatitis C 1E51.1 Whole blood 9.34E-02 1.76E-01 9.35E-01
Chronic obstructive pulmonary disease CA22 Lung tissue 4.35E-01 -6.82E-02 -1.77E-01
Chronic obstructive pulmonary disease CA22 Small airway epithelium 7.10E-01 2.23E-02 5.25E-02
Chronic rhinosinusitis CA0A Sinus mucosa tissue 5.79E-01 6.48E-02 2.77E-01
Colon cancer 2B90 Colon tissue 4.92E-32 -6.91E-01 -1.07E+00
Coronary artery disease BA80-BA8Z Peripheral blood 7.45E-01 1.78E-02 7.69E-02
Diffuse large B-cell lymphoma 2A81 Tonsil tissue 2.62E-02 -3.72E-01 -8.78E-01
Endometriosis GA10 Endometrium tissue 4.34E-02 -4.80E-01 -7.82E-01
Familial hypercholesterolemia 5C80.00 Peripheral blood 7.07E-01 -3.89E-02 -3.63E-01
Familial hypercholesterolemia 5C80.00 Whole blood 4.81E-01 6.37E-02 4.54E-01
Gastric cancer 2B72 Gastric tissue 3.26E-01 -9.49E-01 -8.33E-01
Glioblastopma 2A00.00 Nervous tissue 4.11E-01 -7.69E-02 -1.16E-01
Glioma 2A00.0Y-2A00.0Z Brain stem tissue 4.56E-02 5.32E-01 3.10E+00
Glioma 2A00.0Y-2A00.0Z White matter tissue 1.08E-03 1.08E+00 1.46E+00
Head and neck cancer 2D42 Head and neck tissue 5.00E-10 -6.26E-01 -8.75E-01
HIV-associated neurocognitive impairment 8A2Y-8A2Z White matter tissue 1.06E-01 -1.80E-01 -4.27E-01
Huntington's disease 8A01.10 Whole blood 2.91E-01 1.44E-02 1.03E-01
Idiopathic pulmonary fibrosis CB03.4 Lung tissue 6.54E-01 -2.63E-01 -8.01E-01
Immunodeficiency 4A00-4A20 Peripheral blood 1.60E-02 9.36E-02 7.74E-01
Influenza 1E30 Whole blood 1.22E-01 -8.33E-01 -1.27E+00
Interstitial cystitis GC00.3 Bladder tissue 3.65E-05 -2.31E+00 -4.76E+00
Intracranial aneurysm 8B01.0 Intracranial artery 8.15E-01 3.98E-02 1.02E-01
Irritable bowel syndrome DD91.0 Rectal colon tissue 1.20E-03 -1.15E-01 -3.63E-01
Ischemic stroke 8B11 Peripheral blood 8.55E-01 -3.37E-02 -1.74E-01
Juvenile idiopathic arthritis FA24 Peripheral blood 6.31E-03 1.94E-01 5.62E-01
Lateral sclerosis 8B60.4 Skin 9.02E-01 -2.25E-02 -2.13E-01
Lateral sclerosis 8B60.4 Cervical spinal cord 2.23E-01 -4.88E-01 -5.09E-01
Liver cancer 2C12.0 Liver tissue 9.87E-06 -6.70E-01 -8.10E-01
Liver failure DB99.7-DB99.8 Liver tissue 2.57E-01 -6.64E-01 -1.24E+00
Lung cancer 2C25 Lung tissue 4.33E-09 1.66E-01 2.53E-01
Lupus erythematosus 4A40 Whole blood 2.37E-02 6.47E-02 1.46E-01
Major depressive disorder 6A70-6A7Z Hippocampus 4.32E-01 5.30E-02 1.09E-01
Major depressive disorder 6A70-6A7Z Whole blood 6.83E-02 1.18E-02 4.93E-02
Melanoma 2C30 Skin 7.72E-01 3.19E-01 2.90E-01
Multiple myeloma 2A83.1 Peripheral blood 7.82E-01 8.17E-03 5.54E-02
Multiple myeloma 2A83.1 Bone marrow 4.50E-03 -6.01E-01 -1.69E+00
Multiple sclerosis 8A40 Plasmacytoid dendritic cells 8.16E-01 -8.43E-02 -2.25E-01
Myelodysplastic syndrome 2A36-2A3Z Bone marrow 3.16E-03 2.29E-01 5.86E-01
Myelofibrosis 2A20.2 Whole blood 9.55E-04 2.38E-01 1.86E+00
Myocardial infarction BA41-BA50 Peripheral blood 2.03E-01 1.94E-01 2.86E-01
Myopathy 8C70.6 Muscle tissue 4.31E-03 7.75E-01 2.26E+00
Neonatal sepsis KA60 Whole blood 4.39E-17 3.39E-01 1.29E+00
Neuroectodermal tumour 2A00.11 Brain stem tissue 2.08E-04 7.78E-01 1.62E+00
Non-alcoholic fatty liver disease DB92 Liver tissue 2.08E-01 3.49E-01 4.01E-01
Obesity related type 2 diabetes 5A11 Omental adipose tissue 3.64E-02 -6.01E-01 -1.59E+00
Olive pollen allergy CA08.00 Peripheral blood 8.77E-01 -1.29E-01 -1.01E-01
Oral cancer 2B6E Oral tissue 1.05E-02 -7.35E-01 -6.57E-01
Osteoarthritis FA00-FA0Z Synovial tissue 2.00E-01 1.02E+00 7.86E-01
Osteoporosis FB83.1 Bone marrow 4.03E-02 -4.64E-01 -2.27E+00
Ovarian cancer 2C73 Ovarian tissue 1.35E-02 7.50E-01 1.34E+00
Pancreatic cancer 2C10 Pancreas 1.32E-05 1.07E+00 1.48E+00
Parkinson's disease 8A00.0 Substantia nigra tissue 1.57E-01 -2.62E-01 -5.83E-01
Pediatric respiratory syncytial virus infection CA40.11 Peripheral blood 3.42E-02 1.31E-01 6.79E-01
Pituitary cancer 2D12 Pituitary tissue 4.17E-01 -2.38E-01 -3.34E-01
Pituitary gonadotrope tumour 2D12 Pituitary tissue 6.96E-01 -1.51E-01 -2.24E-01
Polycystic ovary syndrome 5A80.1 Vastus lateralis muscle 2.62E-01 -4.69E-02 -1.40E-01
Polycythemia vera 2A20.4 Whole blood 7.33E-17 3.35E-01 2.36E+00
Pompe disease 5C51.3 Biceps muscle 2.08E-03 8.15E-01 1.75E+00
Preterm birth KA21.4Z Myometrium 4.80E-01 1.62E-02 1.93E-02
Prostate cancer 2C82 Prostate 1.51E-03 -8.99E-01 -1.01E+00
Psoriasis EA90 Skin 1.23E-03 1.97E-01 3.20E-01
Rectal cancer 2B92 Rectal colon tissue 7.85E-04 -2.99E-01 -1.27E+00
Renal cancer 2C90-2C91 Kidney 1.93E-07 -1.09E+00 -3.06E+00
Retinoblastoma 2D02.2 Uvea 1.38E-02 3.60E-01 4.58E-01
Rheumatoid arthritis FA20 Synovial tissue 1.85E-03 8.94E-01 1.28E+00
Rhinovirus infection CA42.1 Nasal epithelium tissue 9.08E-01 9.69E-03 3.24E-02
Schizophrenia 6A20 Prefrontal cortex 7.04E-02 -3.34E-01 -2.24E-01
Schizophrenia 6A20 Superior temporal cortex 8.37E-01 -2.37E-01 -5.12E-01
Scleroderma 4A42.Z Whole blood 9.32E-03 1.25E-01 1.03E+00
Seizure 8A60-8A6Z Whole blood 5.84E-01 2.69E-02 1.31E-01
Sensitive skin EK0Z Skin 9.11E-01 3.12E-02 1.35E-01
Sepsis with septic shock 1G41 Whole blood 2.25E-53 5.17E-01 1.73E+00
Shwachman-Diamond syndrome 3A70.0 Bone marrow 2.32E-01 1.39E-02 2.91E-02
Sickle cell disease 3A51.0-3A51.3 Peripheral blood 1.40E-01 1.61E-02 9.49E-02
Simpson golabi behmel syndrome LD2C Adipose tissue 5.49E-01 2.96E-02 2.91E-01
Sjogren's syndrome 4A43.2 Salivary gland tissue 3.14E-01 -5.91E-01 -8.91E-01
Skin cancer 2C30-2C3Z Skin 4.59E-21 -7.64E-01 -1.08E+00
Thrombocythemia 3B63 Whole blood 2.39E-04 1.85E-01 1.27E+00
Thrombocytopenia 3B64 Whole blood 3.96E-01 5.55E-01 1.08E+00
Thyroid cancer 2D10 Thyroid 4.12E-01 -3.65E-02 -5.97E-02
Tibial muscular dystrophy 8C75 Muscle tissue 1.65E-06 1.08E+00 2.38E+00
Tuberous sclerosis complex LD2D.2 Perituberal tissue 7.64E-04 -1.38E+00 -3.97E+00
Type 2 diabetes 5A11 Liver tissue 2.40E-01 -1.13E-01 -2.86E-01
Ureter cancer 2C92 Urothelium 3.75E-01 -1.95E-01 -1.88E-01
Uterine cancer 2C78 Endometrium tissue 1.04E-06 -5.50E-01 -6.37E-01
Vitiligo ED63.0 Skin 6.98E-01 7.16E-02 1.42E-01
------------------------------------------------------------------------------------
⏷ Show the Full List of DME Expression Under 107 Diseases

References

1 Up-regulation of human prostaglandin reductase 1 improves the efficacy of hydroxymethylacylfulvene, an antitumor chemotherapeutic agent. J Pharmacol Exp Ther. 2012 Nov;343(2):426-33.