Details of Drug-Metabolizing Enzyme (DME)

General Information of Drug-Metabolizing Enzyme (DME) (ID: DE4U39Y)

DME Name UDP-glucose pyrophosphorylase (UGPase)
Synonyms UTP--glucose-1-phosphate uridylyltransferase; UDPGP; UGP1; UGP2; UGPase
Gene Name UGP2
UniProt ID
UGPA_HUMAN
INTEDE ID
DME0514
3D Structure
Download
2D Sequence (FASTA)
Download
3D Structure (PDB)
Download
Gene ID
7360
EC Number EC: 2.7.7.9
Transferase
Kinase
Nucleotidyltransferase
EC: 2.7.7.9
Lineage Species: Homo sapiens
Kingdom: Metazoa
Phylum: Chordata
Class: Mammalia
Order: Primates
Family: Hominidae
Genus: Homo
Species: Homo sapiens
Sequence
MSRFVQDLSKAMSQDGASQFQEVIRQELELSVKKELEKILTTASSHEFEHTKKDLDGFRK
LFHRFLQEKGPSVDWGKIQRPPEDSIQPYEKIKARGLPDNISSVLNKLVVVKLNGGLGTS
MGCKGPKSLIGVRNENTFLDLTVQQIEHLNKTYNTDVPLVLMNSFNTDEDTKKILQKYNH
CRVKIYTFNQSRYPRINKESLLPVAKDVSYSGENTEAWYPPGHGDIYASFYNSGLLDTFI
GEGKEYIFVSNIDNLGATVDLYILNHLMNPPNGKRCEFVMEVTNKTRADVKGGTLTQYEG
KLRLVEIAQVPKAHVDEFKSVSKFKIFNTNNLWISLAAVKRLQEQNAIDMEIIVNAKTLD
GGLNVIQLETAVGAAIKSFENSLGINVPRSRFLPVKTTSDLLLVMSNLYSLNAGSLTMSE
KREFPTVPLVKLGSSFTKVQDYLRRFESIPDMLELDHLTVSGDVTFGKNVSLKGTVIIIA
NHGDRIDIPPGAVLENKIVSGNLRILDH
Function This enzyme plays a central role as a glucosyl donor in cellular metabolic pathways.
KEGG Pathway
Amino sugar and nucleotide sugar metabolism (hsa00520 )
Galactose metabolism (hsa00052 )
Metabolic pathways (hsa01100 )
Pentose and glucuronate interconversions (hsa00040 )
Starch and sucrose metabolism (hsa00500 )
Reactome Pathway
Glycogen synthesis (R-HSA-3322077 )
Formation of the active cofactor, UDP-glucuronate (R-HSA-173599 )

Molecular Interaction Atlas (MIA) of This DME

Molecular Interaction Atlas (MIA) Jump to Detail Molecular Interaction Atlas of This DME
1 Investigative Drug(s) Metabolized by This DME
Drug Name Drug ID Indication ICD 11 Highest Status REF
D-glucose 1-phosphate DMPW46G N. A. N. A. Investigative [1]

Molecular Expression Atlas (MEA) of This DME

Molecular Expression Atlas (MEA) Jump to Detail Molecular Expression Atlas of This DME
Disease Name ICD 11 Studied Tissue p-value Fold-Change Z-score
Acute myelocytic leukaemia 2B33.1 Bone marrow 1.00E-21 -7.26E-01 -1.16E+00
Alopecia ED70 Skin from scalp 3.22E-01 -2.39E-02 -1.21E-01
Alzheimer's disease 8A20 Entorhinal cortex 1.51E-01 6.09E-02 3.03E-01
Ankylosing spondylitis FA92.0 Pheripheral blood 5.38E-01 3.50E-02 1.20E-01
Aortic stenosis BB70 Calcified aortic valve 6.74E-01 -1.43E-01 -1.53E-01
Apnea 7A40 Hyperplastic tonsil 2.52E-02 8.51E-01 1.79E+00
Arthropathy FA00-FA5Z Peripheral blood 9.17E-01 -1.37E-02 -1.45E-01
Asthma CA23 Nasal and bronchial airway 2.29E-05 1.69E-01 2.41E-01
Atopic dermatitis EA80 Skin 1.07E-03 -2.72E-01 -1.38E+00
Autism 6A02 Whole blood 1.26E-02 1.75E-01 6.26E-01
Autoimmune uveitis 9A96 Peripheral monocyte 5.16E-01 1.65E-01 6.22E-01
Autosomal dominant monocytopenia 4B04 Whole blood 2.89E-01 -2.96E-02 -7.24E-02
Bacterial infection of gingival 1C1H Gingival tissue 1.03E-04 -2.06E-01 -6.88E-01
Batten disease 5C56.1 Whole blood 2.11E-01 -2.59E-02 -1.60E-01
Behcet's disease 4A62 Peripheral blood 1.45E-01 -1.15E-01 -4.68E-01
Bipolar disorder 6A60-6A6Z Prefrontal cortex 8.95E-01 -1.05E-02 -4.79E-02
Bladder cancer 2C94 Bladder tissue 7.32E-02 -2.98E-01 -1.43E+00
Breast cancer 2C60-2C6Z Breast tissue 1.38E-38 -7.74E-01 -1.15E+00
Cardioembolic stroke 8B11.20 Whole blood 3.90E-05 1.09E-01 1.18E+00
Cervical cancer 2C77 Cervical tissue 2.06E-02 -2.62E-01 -7.30E-01
Childhood onset rheumatic disease FA20.Z Peripheral blood 2.32E-01 2.52E-02 1.01E-01
Chronic hepatitis C 1E51.1 Whole blood 9.61E-01 -1.86E-01 -5.34E-01
Chronic obstructive pulmonary disease CA22 Lung tissue 5.64E-02 1.24E-01 5.68E-01
Chronic obstructive pulmonary disease CA22 Small airway epithelium 9.70E-01 4.95E-02 1.69E-01
Chronic rhinosinusitis CA0A Sinus mucosa tissue 7.00E-01 1.55E-01 3.83E-01
Colon cancer 2B90 Colon tissue 4.05E-57 -9.63E-01 -2.01E+00
Coronary artery disease BA80-BA8Z Peripheral blood 2.08E-01 1.31E+00 9.25E-01
Diffuse large B-cell lymphoma 2A81 Tonsil tissue 5.24E-01 1.36E-01 2.11E-01
Endometriosis GA10 Endometrium tissue 2.56E-02 -7.82E-02 -3.14E-01
Familial hypercholesterolemia 5C80.00 Peripheral blood 7.47E-01 1.02E-01 7.21E-01
Familial hypercholesterolemia 5C80.00 Whole blood 6.28E-03 2.00E-01 7.36E-01
Gastric cancer 2B72 Gastric tissue 9.20E-02 -3.78E-01 -1.30E+00
Glioblastopma 2A00.00 Nervous tissue 4.33E-72 -6.53E-01 -1.60E+00
Glioma 2A00.0Y-2A00.0Z Brain stem tissue 9.95E-01 -9.19E-02 -1.14E-01
Glioma 2A00.0Y-2A00.0Z White matter tissue 9.51E-01 -1.63E-01 -4.52E-01
Head and neck cancer 2D42 Head and neck tissue 3.38E-14 -3.16E-01 -9.88E-01
HIV-associated neurocognitive impairment 8A2Y-8A2Z White matter tissue 4.85E-01 -1.06E-01 -3.45E-01
Huntington's disease 8A01.10 Whole blood 9.38E-01 -4.70E-02 -1.37E-01
Idiopathic pulmonary fibrosis CB03.4 Lung tissue 2.77E-01 -5.80E-02 -1.64E-01
Immunodeficiency 4A00-4A20 Peripheral blood 8.72E-01 -1.65E-03 -2.61E-02
Influenza 1E30 Whole blood 8.91E-01 -2.81E-01 -1.07E+00
Interstitial cystitis GC00.3 Bladder tissue 1.49E-01 5.45E-02 2.17E-01
Intracranial aneurysm 8B01.0 Intracranial artery 1.12E-01 -3.49E-01 -1.31E+00
Irritable bowel syndrome DD91.0 Rectal colon tissue 2.86E-01 6.37E-02 3.37E-01
Ischemic stroke 8B11 Peripheral blood 7.12E-02 -1.57E-01 -6.12E-01
Juvenile idiopathic arthritis FA24 Peripheral blood 6.46E-02 1.84E-02 1.29E-01
Lateral sclerosis 8B60.4 Skin 8.50E-01 -6.10E-02 -2.13E-01
Lateral sclerosis 8B60.4 Cervical spinal cord 1.18E-01 -1.75E-01 -4.05E-01
Liver cancer 2C12.0 Liver tissue 2.42E-13 -1.21E+00 -1.62E+00
Liver failure DB99.7-DB99.8 Liver tissue 1.33E-06 -2.23E+00 -3.82E+00
Lung cancer 2C25 Lung tissue 3.25E-12 2.50E-01 6.91E-01
Lupus erythematosus 4A40 Whole blood 1.81E-03 1.29E-01 3.91E-01
Major depressive disorder 6A70-6A7Z Hippocampus 7.32E-01 -3.58E-02 -1.60E-01
Major depressive disorder 6A70-6A7Z Whole blood 1.03E-01 -3.34E-02 -2.33E-01
Melanoma 2C30 Skin 4.68E-01 -9.66E-03 -1.65E-02
Multiple myeloma 2A83.1 Peripheral blood 6.74E-01 -1.46E-02 -1.04E-01
Multiple myeloma 2A83.1 Bone marrow 3.43E-05 5.03E-01 2.96E+00
Multiple sclerosis 8A40 Plasmacytoid dendritic cells 5.16E-01 -1.11E-02 -6.23E-02
Myelodysplastic syndrome 2A36-2A3Z Bone marrow 3.43E-01 -9.63E-02 -2.22E-01
Myelofibrosis 2A20.2 Whole blood 4.67E-02 -9.36E-02 -5.47E-01
Myocardial infarction BA41-BA50 Peripheral blood 1.40E-01 -2.47E-01 -4.80E-01
Myopathy 8C70.6 Muscle tissue 3.83E-01 3.05E-01 6.81E-01
Neonatal sepsis KA60 Whole blood 9.04E-08 2.98E-01 8.13E-01
Neuroectodermal tumour 2A00.11 Brain stem tissue 1.27E-01 1.54E-01 4.99E-01
Non-alcoholic fatty liver disease DB92 Liver tissue 1.57E-01 3.18E-01 4.51E-01
Obesity related type 2 diabetes 5A11 Omental adipose tissue 3.06E-01 6.49E-01 7.93E-01
Olive pollen allergy CA08.00 Peripheral blood 3.59E-01 -3.95E-01 -9.02E-01
Oral cancer 2B6E Oral tissue 4.14E-01 1.90E-01 2.64E-01
Osteoarthritis FA00-FA0Z Synovial tissue 2.60E-01 -5.30E-01 -5.64E-01
Osteoporosis FB83.1 Bone marrow 2.42E-01 -1.14E-01 -2.17E+00
Ovarian cancer 2C73 Ovarian tissue 4.72E-02 -3.19E-01 -8.36E-01
Pancreatic cancer 2C10 Pancreas 6.04E-01 1.66E-01 2.80E-01
Parkinson's disease 8A00.0 Substantia nigra tissue 1.49E-01 7.20E-02 2.54E-01
Pediatric respiratory syncytial virus infection CA40.11 Peripheral blood 7.34E-01 8.54E-02 2.92E-01
Pituitary cancer 2D12 Pituitary tissue 4.94E-04 -1.10E+00 -1.96E+00
Pituitary gonadotrope tumour 2D12 Pituitary tissue 1.55E-03 -9.74E-01 -1.99E+00
Polycystic ovary syndrome 5A80.1 Vastus lateralis muscle 6.23E-01 8.00E-03 5.14E-02
Polycythemia vera 2A20.4 Whole blood 7.33E-07 -1.83E-01 -1.07E+00
Pompe disease 5C51.3 Biceps muscle 7.54E-04 6.35E-01 2.55E+00
Preterm birth KA21.4Z Myometrium 9.09E-02 1.92E-01 9.18E-01
Prostate cancer 2C82 Prostate 2.78E-05 -3.92E-01 -1.01E+00
Psoriasis EA90 Skin 7.10E-03 2.52E-01 5.38E-01
Rectal cancer 2B92 Rectal colon tissue 2.14E-02 -4.14E-01 -1.62E+00
Renal cancer 2C90-2C91 Kidney 2.75E-01 1.64E-02 8.41E-02
Retinoblastoma 2D02.2 Uvea 1.44E-04 5.45E-01 1.94E+00
Rheumatoid arthritis FA20 Synovial tissue 1.08E-02 -9.60E-01 -1.56E+00
Rhinovirus infection CA42.1 Nasal epithelium tissue 3.58E-01 2.45E-02 1.79E-01
Schizophrenia 6A20 Prefrontal cortex 1.83E-01 -5.74E-02 -1.88E-01
Schizophrenia 6A20 Superior temporal cortex 5.12E-02 7.88E-02 4.95E-01
Scleroderma 4A42.Z Whole blood 2.16E-01 -1.28E-01 -9.22E-01
Seizure 8A60-8A6Z Whole blood 3.68E-01 1.54E-01 5.67E-01
Sensitive skin EK0Z Skin 5.34E-02 -1.52E-01 -1.62E+00
Sepsis with septic shock 1G41 Whole blood 3.18E-13 3.18E-01 9.12E-01
Shwachman-Diamond syndrome 3A70.0 Bone marrow 1.87E-01 -4.36E-01 -9.43E-01
Sickle cell disease 3A51.0-3A51.3 Peripheral blood 3.33E-03 -7.99E-01 -1.95E+00
Simpson golabi behmel syndrome LD2C Adipose tissue 5.01E-01 2.71E-01 3.11E-01
Sjogren's syndrome 4A43.2 Salivary gland tissue 3.15E-01 3.35E-01 1.24E+00
Skin cancer 2C30-2C3Z Skin 6.79E-01 3.26E-02 7.29E-02
Thrombocythemia 3B63 Whole blood 5.92E-03 -2.60E-01 -1.50E+00
Thrombocytopenia 3B64 Whole blood 5.89E-01 -4.72E-01 -5.80E-01
Thyroid cancer 2D10 Thyroid 9.30E-03 1.14E-01 3.41E-01
Tibial muscular dystrophy 8C75 Muscle tissue 4.19E-01 1.02E-01 2.16E-01
Tuberous sclerosis complex LD2D.2 Perituberal tissue 2.07E-01 -1.06E-01 -3.25E-01
Type 2 diabetes 5A11 Liver tissue 1.36E-01 2.07E-01 6.78E-01
Ureter cancer 2C92 Urothelium 7.02E-01 1.87E-01 5.78E-01
Uterine cancer 2C78 Endometrium tissue 5.62E-07 4.10E-01 7.12E-01
Vitiligo ED63.0 Skin 6.41E-01 1.78E-02 1.00E-01
------------------------------------------------------------------------------------
⏷ Show the Full List of DME Expression Under 107 Diseases

References

1 The crystal structure of human UDP-glucose pyrophosphorylase reveals a latch effect that influences enzymatic activity. Biochem J. 2012 Mar 1;442(2):283-91.