Details of Drug-Metabolizing Enzyme (DME)

General Information of Drug-Metabolizing Enzyme (DME) (ID: DE5FUD0)

DME Name Methylsterol monooxygenase 1 (MSMO1)
Synonyms C-4 methylsterol oxidase; DESP4; ERG25; MSMO1; SC4MOL
Gene Name MSMO1
UniProt ID
MSMO1_HUMAN
INTEDE ID
DME0425
3D Structure
Download
2D Sequence (FASTA)
Download
3D Structure (PDB)
Download
Gene ID
6307
EC Number EC: 1.14.13.72
Oxidoreductase
Oxygen paired donor oxidoreductase
NADH/NADPH donor oxidoreductase
EC: 1.14.13.72
Lineage Species: Homo sapiens
Kingdom: Metazoa
Phylum: Chordata
Class: Mammalia
Order: Primates
Family: Hominidae
Genus: Homo
Species: Homo sapiens
Sequence
MATNESVSIFSSASLAVEYVDSLLPENPLQEPFKNAWNYMLNNYTKFQIATWGSLIVHEA
LYFLFCLPGFLFQFIPYMKKYKIQKDKPETWENQWKCFKVLLFNHFCIQLPLICGTYYFT
EYFNIPYDWERMPRWYFLLARCFGCAVIEDTWHYFLHRLLHHKRIYKYIHKVHHEFQAPF
GMEAEYAHPLETLILGTGFFIGIVLLCDHVILLWAWVTIRLLETIDVHSGYDIPLNPLNL
IPFYAGSRHHDFHHMNFIGNYASTFTWWDRIFGTDSQYNAYNEKRKKFEKKTE
Function This enzyme catalyzes the first step in the removal of the two C-4 methyl groups of 4,4-dimethylzymosterol.
KEGG Pathway
Metabolic pathways (hsa01100 )
Steroid biosynthesis (hsa00100 )
Reactome Pathway
Cholesterol biosynthesis (R-HSA-191273 )

Molecular Interaction Atlas (MIA) of This DME

Molecular Interaction Atlas (MIA) Jump to Detail Molecular Interaction Atlas of This DME
1 Clinical Trial Drug(s) Metabolized by This DME
Drug Name Drug ID Indication ICD 11 Highest Status REF
ED-71 DMRLXAI N. A. N. A. Phase 3 [1]

Molecular Expression Atlas (MEA) of This DME

Molecular Expression Atlas (MEA) Jump to Detail Molecular Expression Atlas of This DME
Disease Name ICD 11 Studied Tissue p-value Fold-Change Z-score
Acute myelocytic leukaemia 2B33.1 Bone marrow 2.72E-05 3.60E-01 5.20E-01
Alopecia ED70 Skin from scalp 3.81E-02 1.03E-01 4.84E-01
Alzheimer's disease 8A20 Entorhinal cortex 8.62E-01 1.15E-01 2.84E-01
Ankylosing spondylitis FA92.0 Pheripheral blood 8.01E-01 -2.62E-02 -8.34E-02
Aortic stenosis BB70 Calcified aortic valve 9.14E-01 -4.02E-01 -3.18E-01
Apnea 7A40 Hyperplastic tonsil 8.48E-01 9.93E-02 2.54E-01
Arthropathy FA00-FA5Z Peripheral blood 5.49E-02 -4.93E-01 -1.45E+00
Asthma CA23 Nasal and bronchial airway 8.27E-01 -3.01E-02 -5.92E-02
Atopic dermatitis EA80 Skin 3.25E-03 -3.33E-01 -4.21E-01
Autism 6A02 Whole blood 9.32E-01 -1.01E-02 -2.56E-02
Autoimmune uveitis 9A96 Peripheral monocyte 1.07E-01 2.36E+00 8.95E+00
Autosomal dominant monocytopenia 4B04 Whole blood 5.08E-05 1.64E+00 3.12E+00
Bacterial infection of gingival 1C1H Gingival tissue 4.43E-09 -3.61E-01 -8.72E-01
Batten disease 5C56.1 Whole blood 3.92E-01 -1.42E-02 -6.24E-02
Behcet's disease 4A62 Peripheral blood 8.75E-01 -2.53E-02 -5.84E-02
Bipolar disorder 6A60-6A6Z Prefrontal cortex 6.46E-01 1.29E-02 7.70E-02
Bladder cancer 2C94 Bladder tissue 6.52E-01 1.24E-02 4.75E-02
Breast cancer 2C60-2C6Z Breast tissue 5.13E-25 6.71E-01 6.41E-01
Cardioembolic stroke 8B11.20 Whole blood 4.04E-02 1.35E-01 7.38E-01
Cervical cancer 2C77 Cervical tissue 1.33E-02 -5.39E-01 -8.11E-01
Childhood onset rheumatic disease FA20.Z Peripheral blood 4.18E-01 2.40E-01 1.71E-01
Chronic hepatitis C 1E51.1 Whole blood 1.11E-01 3.64E-02 1.35E-01
Chronic obstructive pulmonary disease CA22 Lung tissue 4.61E-01 5.72E-02 1.22E-01
Chronic obstructive pulmonary disease CA22 Small airway epithelium 7.61E-01 -2.67E-02 -5.96E-02
Chronic rhinosinusitis CA0A Sinus mucosa tissue 2.10E-02 -1.04E+00 -1.04E+00
Colon cancer 2B90 Colon tissue 8.42E-06 3.14E-01 4.19E-01
Coronary artery disease BA80-BA8Z Peripheral blood 4.09E-01 1.45E-01 1.81E-01
Diffuse large B-cell lymphoma 2A81 Tonsil tissue 5.56E-01 5.99E-02 1.80E-01
Endometriosis GA10 Endometrium tissue 1.92E-01 -6.81E-01 -7.39E-01
Familial hypercholesterolemia 5C80.00 Peripheral blood 3.06E-02 2.21E-01 8.57E-01
Familial hypercholesterolemia 5C80.00 Whole blood 6.11E-02 4.47E-01 1.03E+00
Gastric cancer 2B72 Gastric tissue 3.10E-01 9.44E-01 8.01E-01
Glioblastopma 2A00.00 Nervous tissue 4.15E-08 -1.39E-01 -2.30E-01
Glioma 2A00.0Y-2A00.0Z Brain stem tissue 7.16E-01 4.24E-01 3.22E-01
Glioma 2A00.0Y-2A00.0Z White matter tissue 9.31E-01 6.84E-02 8.80E-02
Head and neck cancer 2D42 Head and neck tissue 5.54E-07 -3.38E-01 -5.42E-01
HIV-associated neurocognitive impairment 8A2Y-8A2Z White matter tissue 4.32E-01 -3.02E-02 -5.23E-02
Huntington's disease 8A01.10 Whole blood 2.30E-02 -6.47E-01 -1.31E+00
Idiopathic pulmonary fibrosis CB03.4 Lung tissue 2.57E-02 -1.16E+00 -1.60E+00
Immunodeficiency 4A00-4A20 Peripheral blood 3.97E-04 3.37E-01 3.96E+00
Influenza 1E30 Whole blood 1.75E-01 -1.97E+00 -1.88E+00
Interstitial cystitis GC00.3 Bladder tissue 2.43E-03 -8.38E-01 -2.63E+00
Intracranial aneurysm 8B01.0 Intracranial artery 7.04E-01 2.59E-01 3.39E-01
Irritable bowel syndrome DD91.0 Rectal colon tissue 8.92E-02 1.44E-01 3.38E-01
Ischemic stroke 8B11 Peripheral blood 1.50E-01 -1.55E-01 -3.14E-01
Juvenile idiopathic arthritis FA24 Peripheral blood 5.16E-01 -6.88E-02 -1.53E-01
Lateral sclerosis 8B60.4 Skin 2.72E-01 -2.22E-01 -7.35E-01
Lateral sclerosis 8B60.4 Cervical spinal cord 9.51E-01 -4.33E-02 -4.67E-02
Liver cancer 2C12.0 Liver tissue 5.20E-06 -3.95E-01 -6.92E-01
Liver failure DB99.7-DB99.8 Liver tissue 2.35E-05 -2.58E+00 -3.31E+00
Lung cancer 2C25 Lung tissue 1.43E-76 -1.07E+00 -2.40E+00
Lupus erythematosus 4A40 Whole blood 3.54E-02 4.32E-01 4.35E-01
Major depressive disorder 6A70-6A7Z Hippocampus 8.67E-01 -1.98E-02 -1.29E-01
Major depressive disorder 6A70-6A7Z Whole blood 4.40E-01 -4.62E-02 -1.17E-01
Melanoma 2C30 Skin 1.02E-10 -1.32E+00 -1.94E+00
Multiple myeloma 2A83.1 Peripheral blood 7.41E-01 1.49E-01 1.90E-01
Multiple myeloma 2A83.1 Bone marrow 9.47E-06 1.18E+00 3.42E+00
Multiple sclerosis 8A40 Plasmacytoid dendritic cells 4.92E-03 -7.21E-01 -2.21E+00
Myelodysplastic syndrome 2A36-2A3Z Bone marrow 5.91E-02 3.77E-02 5.48E-02
Myelofibrosis 2A20.2 Whole blood 8.34E-02 4.78E-01 1.16E+00
Myocardial infarction BA41-BA50 Peripheral blood 2.09E-01 -3.99E-01 -4.81E-01
Myopathy 8C70.6 Muscle tissue 1.36E-02 5.28E-01 1.24E+00
Neonatal sepsis KA60 Whole blood 1.33E-01 2.41E-02 4.21E-02
Neuroectodermal tumour 2A00.11 Brain stem tissue 4.02E-01 3.98E-02 5.96E-02
Non-alcoholic fatty liver disease DB92 Liver tissue 8.43E-02 -2.83E-02 -6.99E-02
Obesity related type 2 diabetes 5A11 Omental adipose tissue 7.01E-02 -3.11E-01 -1.39E+00
Olive pollen allergy CA08.00 Peripheral blood 6.89E-04 -6.45E-01 -5.83E+00
Oral cancer 2B6E Oral tissue 1.61E-01 6.72E-02 5.45E-02
Osteoarthritis FA00-FA0Z Synovial tissue 1.02E-01 6.57E-01 5.32E-01
Osteoporosis FB83.1 Bone marrow 5.70E-01 -1.35E-01 -6.00E-01
Ovarian cancer 2C73 Ovarian tissue 9.07E-01 3.08E-01 3.10E-01
Pancreatic cancer 2C10 Pancreas 4.17E-03 7.31E-01 7.70E-01
Parkinson's disease 8A00.0 Substantia nigra tissue 9.64E-01 -2.56E-01 -4.09E-01
Pediatric respiratory syncytial virus infection CA40.11 Peripheral blood 1.18E-01 2.87E-01 8.15E-01
Pituitary cancer 2D12 Pituitary tissue 2.97E-02 7.27E-01 1.02E+00
Pituitary gonadotrope tumour 2D12 Pituitary tissue 1.89E-01 5.63E-01 9.52E-01
Polycystic ovary syndrome 5A80.1 Vastus lateralis muscle 9.15E-01 2.37E-02 5.77E-02
Polycythemia vera 2A20.4 Whole blood 4.07E-03 2.50E-01 6.20E-01
Pompe disease 5C51.3 Biceps muscle 1.90E-03 5.22E-01 2.22E+00
Preterm birth KA21.4Z Myometrium 1.93E-01 3.32E-01 1.93E+00
Prostate cancer 2C82 Prostate 2.77E-01 1.19E-01 1.34E-01
Psoriasis EA90 Skin 1.24E-02 -1.93E-01 -3.25E-01
Rectal cancer 2B92 Rectal colon tissue 5.19E-01 9.49E-02 1.99E-01
Renal cancer 2C90-2C91 Kidney 2.01E-01 1.73E-01 2.60E-01
Retinoblastoma 2D02.2 Uvea 1.43E-07 -1.89E+00 -3.00E+00
Rheumatoid arthritis FA20 Synovial tissue 4.83E-03 4.63E-02 6.33E-02
Rhinovirus infection CA42.1 Nasal epithelium tissue 1.70E-01 -7.40E-02 -1.84E-01
Schizophrenia 6A20 Prefrontal cortex 3.42E-02 -5.21E-01 -6.03E-01
Schizophrenia 6A20 Superior temporal cortex 2.56E-01 -2.04E-01 -5.57E-01
Scleroderma 4A42.Z Whole blood 8.03E-01 -8.04E-02 -3.61E-01
Seizure 8A60-8A6Z Whole blood 5.83E-01 2.63E-01 6.37E-01
Sensitive skin EK0Z Skin 4.54E-01 -2.06E-01 -9.71E-01
Sepsis with septic shock 1G41 Whole blood 6.15E-04 1.01E-01 1.71E-01
Shwachman-Diamond syndrome 3A70.0 Bone marrow 5.49E-01 1.31E-01 1.53E-01
Sickle cell disease 3A51.0-3A51.3 Peripheral blood 9.71E-03 -1.33E+00 -1.60E+00
Simpson golabi behmel syndrome LD2C Adipose tissue 3.66E-01 -1.90E-01 -1.43E+00
Sjogren's syndrome 4A43.2 Salivary gland tissue 6.79E-01 -1.82E-01 -5.14E-01
Skin cancer 2C30-2C3Z Skin 6.68E-55 -1.27E+00 -1.80E+00
Thrombocythemia 3B63 Whole blood 5.76E-02 2.82E-01 6.99E-01
Thrombocytopenia 3B64 Whole blood 5.23E-01 -4.12E-01 -4.70E-01
Thyroid cancer 2D10 Thyroid 4.00E-09 2.89E-01 8.64E-01
Tibial muscular dystrophy 8C75 Muscle tissue 1.96E-04 5.82E-01 1.39E+00
Tuberous sclerosis complex LD2D.2 Perituberal tissue 7.33E-01 -8.28E-02 -4.15E-01
Type 2 diabetes 5A11 Liver tissue 2.06E-02 3.21E-01 8.81E-01
Ureter cancer 2C92 Urothelium 9.21E-01 3.14E-03 4.78E-03
Uterine cancer 2C78 Endometrium tissue 1.89E-10 7.46E-01 7.76E-01
Vitiligo ED63.0 Skin 5.82E-01 -2.79E-01 -8.52E-01
------------------------------------------------------------------------------------
⏷ Show the Full List of DME Expression Under 107 Diseases

References

1 Human hepatic metabolism of the anti-osteoporosis drug eldecalcitol involves sterol C4-methyl oxidase. Pharmacol Res Perspect. 2015 Mar;3(2):e00120.