Details of Drug-Metabolizing Enzyme (DME)

General Information of Drug-Metabolizing Enzyme (DME) (ID: DE5LFD8)

DME Name Phosphoribosylformylglycinamidine synthase (PFAS)
Synonyms Formylglycinamide ribonucleotide amidotransferase; Formylglycinamide ribotide amidotransferase; FGAM synthase; FGAR amidotransferase; FGAR-AT; FGAMS; KIAA0361; PFAS
Gene Name PFAS
UniProt ID
PUR4_HUMAN
INTEDE ID
DME0161
3D Structure
Download
2D Sequence (FASTA)
Download
3D Structure (PDB)
Download
Gene ID
5198
EC Number EC: 6.3.5.3
Ligase
Carbon-nitrogen ligase
Carbon-nitrogen ligase
EC: 6.3.5.3
Lineage Species: Homo sapiens
Kingdom: Metazoa
Phylum: Chordata
Class: Mammalia
Order: Primates
Family: Hominidae
Genus: Homo
Species: Homo sapiens
Sequence
MSPVLHFYVRPSGHEGAAPGHTRRKLQGKLPELQGVETELCYNVNWTAEALPSAEETKKL
MWLFGCPLLLDDVARESWLLPGSNDLLLEVGPRLNFSTPTSTNIVSVCRATGLGPVDRVE
TTRRYRLSFAHPPSAEVEAIALATLHDRMTEQHFPHPIQSFSPESMPEPLNGPINILGEG
RLALEKANQELGLALDSWDLDFYTKRFQELQRNPSTVEAFDLAQSNSEHSRHWFFKGQLH
VDGQKLVHSLFESIMSTQESSNPNNVLKFCDNSSAIQGKEVRFLRPEDPTRPSRFQQQQG
LRHVVFTAETHNFPTGVCPFSGATTGTGGRIRDVQCTGRGAHVVAGTAGYCFGNLHIPGY
NLPWEDPSFQYPGNFARPLEVAIEASNGASDYGNKFGEPVLAGFARSLGLQLPDGQRREW
IKPIMFSGGIGSMEADHISKEAPEPGMEVVKVGGPVYRIGVGGGAASSVQVQGDNTSDLD
FGAVQRGDPEMEQKMNRVIRACVEAPKGNPICSLHDQGAGGNGNVLKELSDPAGAIIYTS
RFQLGDPTLNALEIWGAEYQESNALLLRSPNRDFLTHVSARERCPACFVGTITGDRRIVL
VDDRECPVRRNGQGDAPPTPLPTPVDLELEWVLGKMPRKEFFLQRKPPMLQPLALPPGLS
VHQALERVLRLPAVASKRYLTNKVDRSVGGLVAQQQCVGPLQTPLADVAVVALSHEELIG
AATALGEQPVKSLLDPKVAARLAVAEALTNLVFALVTDLRDVKCSGNWMWAAKLPGEGAA
LADACEAMVAVMAALGVAVDGGKDSLSMAARVGTETVRAPGSLVISAYAVCPDITATVTP
DLKHPEGRGHLLYVALSPGQHRLGGTALAQCFSQLGEHPPDLDLPENLVRAFSITQGLLK
DRLLCSGHDVSDGGLVTCLLEMAFAGNCGLQVDVPVPRVDVLSVLFAEEPGLVLEVQEPD
LAQVLKRYRDAGLHCLELGHTGEAGPHAMVRVSVNGAVVLEEPVGELRALWEETSFQLDR
LQAEPRCVAEEERGLRERMGPSYCLPPTFPKASVPREPGGPSPRVAILREEGSNGDREMA
DAFHLAGFEVWDVTMQDLCSGAIGLDTFRGVAFVGGFSYADVLGSAKGWAAAVTFHPRAG
AELRRFRKRPDTFSLGVCNGCQLLALLGWVGGDPNEDAAEMGPDSQPARPGLLLRHNLSG
RYESRWASVRVGPGPALMLRGMEGAVLPVWSAHGEGYVAFSSPELQAQIEARGLAPLHWA
DDDGNPTEQYPLNPNGSPGGVAGICSCDGRHLAVMPHPERAVRPWQWAWRPPPFDTLTTS
PWLQLFINARNWTLEGSC
Function This enzyme catalyzes the ATP-dependent conversion of formylglycinamide ribonucleotide (FGAR) and glutamine to yield formylglycinamidine ribonucleotide (FGAM) and glutamate.
KEGG Pathway
Metabolic pathways (hsa01100 )
Purine metabolism (hsa00230 )
Reactome Pathway
Purine ribonucleoside monophosphate biosynthesis (R-HSA-73817 )

Molecular Expression Atlas (MEA) of This DME

Molecular Expression Atlas (MEA) Jump to Detail Molecular Expression Atlas of This DME
Disease Name ICD 11 Studied Tissue p-value Fold-Change Z-score
Acute myelocytic leukaemia 2B33.1 Bone marrow 6.28E-02 2.01E-01 3.27E-01
Alopecia ED70 Skin from scalp 1.34E-02 1.07E-01 3.29E-01
Alzheimer's disease 8A20 Entorhinal cortex 5.79E-04 -1.30E-01 -6.38E-01
Ankylosing spondylitis FA92.0 Pheripheral blood 4.13E-02 2.50E-01 9.53E-01
Aortic stenosis BB70 Calcified aortic valve 3.83E-01 1.34E-01 2.57E-01
Apnea 7A40 Hyperplastic tonsil 5.34E-01 -1.31E-01 -2.91E-01
Arthropathy FA00-FA5Z Peripheral blood 2.35E-01 -4.72E-01 -1.14E+00
Asthma CA23 Nasal and bronchial airway 1.04E-04 2.91E-01 2.79E-01
Atopic dermatitis EA80 Skin 7.28E-09 3.85E-01 2.06E+00
Autism 6A02 Whole blood 2.48E-01 -2.31E-03 -4.70E-03
Autoimmune uveitis 9A96 Peripheral monocyte 4.16E-01 5.53E-02 1.18E-01
Autosomal dominant monocytopenia 4B04 Whole blood 4.20E-01 -3.09E-01 -1.12E+00
Bacterial infection of gingival 1C1H Gingival tissue 2.97E-01 -3.37E-02 -9.79E-02
Batten disease 5C56.1 Whole blood 9.20E-01 3.42E-02 1.98E-01
Behcet's disease 4A62 Peripheral blood 3.13E-01 -1.16E-01 -5.00E-01
Bipolar disorder 6A60-6A6Z Prefrontal cortex 2.72E-01 -1.85E-02 -1.25E-01
Bladder cancer 2C94 Bladder tissue 7.53E-03 -7.97E-01 -2.09E+00
Breast cancer 2C60-2C6Z Breast tissue 8.05E-15 2.88E-01 6.53E-01
Cardioembolic stroke 8B11.20 Whole blood 1.66E-03 -1.85E-01 -7.45E-01
Cervical cancer 2C77 Cervical tissue 4.26E-01 3.23E-02 6.77E-02
Childhood onset rheumatic disease FA20.Z Peripheral blood 2.90E-01 1.57E-01 1.30E-01
Chronic hepatitis C 1E51.1 Whole blood 9.57E-01 -4.60E-02 -1.83E-01
Chronic obstructive pulmonary disease CA22 Lung tissue 3.77E-01 -5.99E-02 -1.55E-01
Chronic obstructive pulmonary disease CA22 Small airway epithelium 1.62E-01 -9.08E-02 -3.12E-01
Chronic rhinosinusitis CA0A Sinus mucosa tissue 4.70E-01 -2.53E-01 -9.57E-01
Colon cancer 2B90 Colon tissue 2.36E-33 5.73E-01 1.27E+00
Coronary artery disease BA80-BA8Z Peripheral blood 8.73E-01 -1.23E-01 -1.81E-01
Diffuse large B-cell lymphoma 2A81 Tonsil tissue 4.28E-01 2.14E-01 2.55E-01
Endometriosis GA10 Endometrium tissue 4.76E-03 -4.51E-01 -9.72E-01
Familial hypercholesterolemia 5C80.00 Peripheral blood 1.91E-01 1.31E-01 5.49E-01
Familial hypercholesterolemia 5C80.00 Whole blood 8.65E-01 4.00E-02 1.24E-01
Gastric cancer 2B72 Gastric tissue 2.10E-01 6.68E-01 9.45E-01
Glioblastopma 2A00.00 Nervous tissue 1.26E-102 8.54E-01 1.76E+00
Glioma 2A00.0Y-2A00.0Z Brain stem tissue 2.96E-01 3.24E-01 1.29E+00
Glioma 2A00.0Y-2A00.0Z White matter tissue 2.38E-01 1.23E-01 2.13E-01
Head and neck cancer 2D42 Head and neck tissue 1.41E-08 3.26E-01 8.83E-01
HIV-associated neurocognitive impairment 8A2Y-8A2Z White matter tissue 6.21E-01 1.22E-02 4.94E-02
Huntington's disease 8A01.10 Whole blood 3.67E-01 -2.42E-02 -1.25E-01
Idiopathic pulmonary fibrosis CB03.4 Lung tissue 9.28E-01 2.28E-01 5.03E-01
Immunodeficiency 4A00-4A20 Peripheral blood 9.61E-01 4.81E-02 3.07E-01
Influenza 1E30 Whole blood 1.70E-01 -7.25E-01 -1.20E+00
Interstitial cystitis GC00.3 Bladder tissue 3.39E-01 3.54E-02 1.62E-01
Intracranial aneurysm 8B01.0 Intracranial artery 9.58E-02 1.37E-01 4.59E-01
Irritable bowel syndrome DD91.0 Rectal colon tissue 8.14E-07 2.28E-01 8.42E-01
Ischemic stroke 8B11 Peripheral blood 9.74E-01 -3.63E-02 -1.05E-01
Juvenile idiopathic arthritis FA24 Peripheral blood 1.76E-02 1.10E-02 2.22E-02
Lateral sclerosis 8B60.4 Skin 5.61E-02 5.92E-01 2.76E+00
Lateral sclerosis 8B60.4 Cervical spinal cord 7.79E-01 -1.28E-01 -2.50E-01
Liver cancer 2C12.0 Liver tissue 4.13E-14 4.96E-01 1.20E+00
Liver failure DB99.7-DB99.8 Liver tissue 8.16E-01 -3.25E-02 -1.29E-01
Lung cancer 2C25 Lung tissue 2.03E-62 5.99E-01 1.75E+00
Lupus erythematosus 4A40 Whole blood 4.79E-01 1.01E-01 1.25E-01
Major depressive disorder 6A70-6A7Z Hippocampus 6.13E-01 1.96E-02 1.42E-01
Major depressive disorder 6A70-6A7Z Whole blood 2.81E-01 -7.76E-02 -2.54E-01
Melanoma 2C30 Skin 2.81E-02 3.09E-01 3.96E-01
Multiple myeloma 2A83.1 Peripheral blood 3.11E-01 -4.74E-01 -4.96E-01
Multiple myeloma 2A83.1 Bone marrow 1.08E-05 1.02E+00 3.52E+00
Multiple sclerosis 8A40 Plasmacytoid dendritic cells 5.39E-04 -5.54E-01 -2.44E+00
Myelodysplastic syndrome 2A36-2A3Z Bone marrow 5.59E-01 -1.24E-01 -1.81E-01
Myelofibrosis 2A20.2 Whole blood 1.65E-02 -1.85E-01 -6.93E-01
Myocardial infarction BA41-BA50 Peripheral blood 1.48E-04 -8.01E-01 -9.12E-01
Myopathy 8C70.6 Muscle tissue 5.37E-01 1.19E-01 2.29E-01
Neonatal sepsis KA60 Whole blood 2.57E-12 -7.25E-01 -1.29E+00
Neuroectodermal tumour 2A00.11 Brain stem tissue 1.88E-07 2.43E+00 4.10E+00
Non-alcoholic fatty liver disease DB92 Liver tissue 1.59E-01 -2.00E-01 -6.62E-01
Obesity related type 2 diabetes 5A11 Omental adipose tissue 8.68E-03 -4.37E-01 -1.47E+00
Olive pollen allergy CA08.00 Peripheral blood 1.83E-01 -8.57E-01 -1.38E+00
Oral cancer 2B6E Oral tissue 1.11E-07 7.45E-01 1.39E+00
Osteoarthritis FA00-FA0Z Synovial tissue 1.03E-01 7.87E-01 1.01E+00
Osteoporosis FB83.1 Bone marrow 8.37E-02 -5.24E-01 -7.76E-01
Ovarian cancer 2C73 Ovarian tissue 1.03E-04 2.69E-01 1.50E+00
Pancreatic cancer 2C10 Pancreas 2.22E-01 -1.40E-01 -2.53E-01
Parkinson's disease 8A00.0 Substantia nigra tissue 4.95E-01 -4.82E-02 -1.71E-01
Pediatric respiratory syncytial virus infection CA40.11 Peripheral blood 5.23E-01 1.69E-02 7.21E-02
Pituitary cancer 2D12 Pituitary tissue 9.23E-03 9.30E-01 1.24E+00
Pituitary gonadotrope tumour 2D12 Pituitary tissue 9.47E-03 8.00E-01 1.07E+00
Polycystic ovary syndrome 5A80.1 Vastus lateralis muscle 4.40E-01 -1.28E-01 -7.03E-01
Polycythemia vera 2A20.4 Whole blood 2.24E-06 -4.14E-01 -1.56E+00
Pompe disease 5C51.3 Biceps muscle 3.45E-02 2.66E-01 1.09E+00
Preterm birth KA21.4Z Myometrium 9.34E-02 -6.55E-01 -1.68E+00
Prostate cancer 2C82 Prostate 1.06E-04 1.35E+00 1.33E+00
Psoriasis EA90 Skin 1.47E-20 4.76E-01 1.20E+00
Rectal cancer 2B92 Rectal colon tissue 5.60E-04 6.96E-01 2.77E+00
Renal cancer 2C90-2C91 Kidney 1.01E-01 7.22E-01 9.44E-01
Retinoblastoma 2D02.2 Uvea 1.89E-05 6.08E-01 1.66E+00
Rheumatoid arthritis FA20 Synovial tissue 4.73E-03 7.26E-01 1.44E+00
Rhinovirus infection CA42.1 Nasal epithelium tissue 5.12E-01 1.81E-02 1.02E-01
Schizophrenia 6A20 Prefrontal cortex 7.80E-01 -1.41E-02 -3.23E-02
Schizophrenia 6A20 Superior temporal cortex 9.90E-01 -1.48E-02 -8.52E-02
Scleroderma 4A42.Z Whole blood 9.05E-02 -6.45E-02 -4.16E-01
Seizure 8A60-8A6Z Whole blood 2.22E-01 2.06E-03 2.72E-03
Sensitive skin EK0Z Skin 5.46E-01 9.15E-02 9.28E-01
Sepsis with septic shock 1G41 Whole blood 9.93E-47 -7.88E-01 -1.68E+00
Shwachman-Diamond syndrome 3A70.0 Bone marrow 4.74E-03 -6.67E-01 -2.02E+00
Sickle cell disease 3A51.0-3A51.3 Peripheral blood 4.29E-02 -2.75E-01 -6.55E-01
Simpson golabi behmel syndrome LD2C Adipose tissue 3.97E-01 -3.59E-01 -1.09E+00
Sjogren's syndrome 4A43.2 Salivary gland tissue 3.11E-01 1.01E+00 1.13E+00
Skin cancer 2C30-2C3Z Skin 9.22E-51 1.41E+00 2.15E+00
Thrombocythemia 3B63 Whole blood 7.28E-01 -1.15E-01 -4.35E-01
Thrombocytopenia 3B64 Whole blood 3.05E-01 2.05E-01 5.23E-01
Thyroid cancer 2D10 Thyroid 9.83E-01 -1.08E-01 -3.25E-01
Tibial muscular dystrophy 8C75 Muscle tissue 1.17E-02 5.53E-01 1.09E+00
Tuberous sclerosis complex LD2D.2 Perituberal tissue 7.04E-01 1.18E-03 4.13E-03
Type 2 diabetes 5A11 Liver tissue 1.74E-01 2.76E-01 1.03E+00
Ureter cancer 2C92 Urothelium 6.71E-01 -1.27E-03 -1.25E-02
Uterine cancer 2C78 Endometrium tissue 5.61E-05 -3.05E-01 -3.10E-01
Vitiligo ED63.0 Skin 4.93E-02 -2.73E-01 -1.04E+00
------------------------------------------------------------------------------------
⏷ Show the Full List of DME Expression Under 107 Diseases