Details of Drug-Metabolizing Enzyme (DME)

General Information of Drug-Metabolizing Enzyme (DME) (ID: DE5Q1SP)

DME Name Inositol tetrakisphosphate 3-phosphatase (MIPP)
Synonyms
Inositol (1,3,4,5)-tetrakisphosphate 3-phosphatase; Ins(1,3,4,5)P(4) 3-phosphatase; Multiple inositol polyphosphate phosphatase 1; 2,3-BPG phosphatase; 2,3-bisphosphoglycerate 3-phosphatase; MINPP1; MIPP; UNQ900/PRO1917
Gene Name MINPP1
UniProt ID
MINP1_HUMAN
INTEDE ID
DME0524
3D Structure
Download
2D Sequence (FASTA)
Download
3D Structure (PDB)
Download
Gene ID
9562
EC Number EC: 3.1.3.62
Hydrolases
Ester bond hydrolase
Phosphoric monoester hydrolase
EC: 3.1.3.62
Lineage Species: Homo sapiens
Kingdom: Metazoa
Phylum: Chordata
Class: Mammalia
Order: Primates
Family: Hominidae
Genus: Homo
Species: Homo sapiens
Sequence
MLRAPGCLLRTSVAPAAALAAALLSSLARCSLLEPRDPVASSLSPYFGTKTRYEDVNPVL
LSGPEAPWRDPELLEGTCTPVQLVALIRHGTRYPTVKQIRKLRQLHGLLQARGSRDGGAS
STGSRDLGAALADWPLWYADWMDGQLVEKGRQDMRQLALRLASLFPALFSRENYGRLRLI
TSSKHRCMDSSAAFLQGLWQHYHPGLPPPDVADMEFGPPTVNDKLMRFFDHCEKFLTEVE
KNATALYHVEAFKTGPEMQNILKKVAATLQVPVNDLNADLIQVAFFTCSFDLAIKGVKSP
WCDVFDIDDAKVLEYLNDLKQYWKRGYGYTINSRSSCTLFQDIFQHLDKAVEQKQRSQPI
SSPVILQFGHAETLLPLLSLMGYFKDKEPLTAYNYKKQMHRKFRSGLIVPYASNLIFVLY
HCENAKTPKEQFRVQMLLNEKVLPLAYSQETVSFYEDLKNHYKDILQSCQTSEECELARA
NSTSDEL
Function
This enzyme acts as a phosphoinositide 5- and phosphoinositide 6- phosphatase and regulates cellular levels of inositol pentakisphosphate (InsP5) and inositol hexakisphosphate (InsP6). It also acts as a 2,3-bisphosphoglycerate 3-phosphatase, by mediating the dephosphorylation of 2,3-bisphosphoglycerate (2,3-BPG) to produce phospho-D-glycerate without formation of 3-phosphoglycerate.
KEGG Pathway
Glycolysis / Gluconeogenesis (hsa00010 )
Inositol phosphate metabolism (hsa00562 )
Metabolic pathways (hsa01100 )
Reactome Pathway
Synthesis of IPs in the ER lumen (R-HSA-1855231 )

Molecular Interaction Atlas (MIA) of This DME

Molecular Interaction Atlas (MIA) Jump to Detail Molecular Interaction Atlas of This DME
1 Investigative Drug(s) Metabolized by This DME
Drug Name Drug ID Indication ICD 11 Highest Status REF
Inositol 1,3,4,5-Tetrakisphosphate DMIFD35 Discovery agent N.A. Investigative [1]
Experimental Enzyme Kinetic Data of Drugs
Drug Name Indication Highest Status Kinetic Data REF
Inositol 1,3,4,5-Tetrakisphosphate Discovery agent [N.A.] Investigative Km = 0.0016 microM [1]

Molecular Expression Atlas (MEA) of This DME

Molecular Expression Atlas (MEA) Jump to Detail Molecular Expression Atlas of This DME
Disease Name ICD 11 Studied Tissue p-value Fold-Change Z-score
Acute myelocytic leukaemia 2B33.1 Bone marrow 1.15E-43 -1.82E+00 -1.90E+00
Alopecia ED70 Skin from scalp 2.55E-01 -7.13E-02 -1.66E-01
Alzheimer's disease 8A20 Entorhinal cortex 7.23E-01 -2.64E-03 -8.96E-03
Ankylosing spondylitis FA92.0 Pheripheral blood 1.07E-01 -1.88E-01 -8.21E-01
Aortic stenosis BB70 Calcified aortic valve 9.75E-01 -1.38E-01 -8.01E-02
Apnea 7A40 Hyperplastic tonsil 1.37E-01 -7.68E-01 -6.41E-01
Arthropathy FA00-FA5Z Peripheral blood 1.28E-01 -3.39E-01 -7.38E-01
Asthma CA23 Nasal and bronchial airway 1.19E-03 1.75E-01 1.74E-01
Atopic dermatitis EA80 Skin 1.83E-07 -5.35E-01 -1.60E+00
Autism 6A02 Whole blood 3.75E-01 -2.11E-01 -4.41E-01
Autoimmune uveitis 9A96 Peripheral monocyte 1.75E-01 5.78E-01 1.01E+00
Autosomal dominant monocytopenia 4B04 Whole blood 1.49E-01 8.02E-02 3.48E-01
Bacterial infection of gingival 1C1H Gingival tissue 2.56E-01 -4.70E-02 -9.02E-02
Batten disease 5C56.1 Whole blood 2.49E-01 -7.04E-02 -3.07E-01
Behcet's disease 4A62 Peripheral blood 8.84E-01 1.39E-01 2.15E-01
Bipolar disorder 6A60-6A6Z Prefrontal cortex 4.13E-01 3.91E-02 2.18E-01
Bladder cancer 2C94 Bladder tissue 3.00E-04 -3.83E-01 -1.62E+00
Breast cancer 2C60-2C6Z Breast tissue 2.93E-20 4.77E-01 7.96E-01
Cardioembolic stroke 8B11.20 Whole blood 2.28E-03 4.61E-01 1.17E+00
Cervical cancer 2C77 Cervical tissue 5.46E-02 4.11E-01 5.82E-01
Childhood onset rheumatic disease FA20.Z Peripheral blood 6.77E-01 1.55E-01 1.14E-01
Chronic hepatitis C 1E51.1 Whole blood 2.86E-01 -4.29E-02 -1.05E-01
Chronic obstructive pulmonary disease CA22 Lung tissue 1.54E-01 -9.51E-02 -2.53E-01
Chronic obstructive pulmonary disease CA22 Small airway epithelium 2.91E-01 -1.28E-01 -3.31E-01
Chronic rhinosinusitis CA0A Sinus mucosa tissue 6.67E-01 1.30E-02 2.65E-02
Colon cancer 2B90 Colon tissue 3.79E-09 -2.08E-01 -4.35E-01
Coronary artery disease BA80-BA8Z Peripheral blood 3.90E-02 2.17E-01 6.69E-01
Diffuse large B-cell lymphoma 2A81 Tonsil tissue 4.18E-01 2.34E-01 2.70E-01
Endometriosis GA10 Endometrium tissue 6.17E-01 -3.04E-01 -2.97E-01
Familial hypercholesterolemia 5C80.00 Peripheral blood 7.88E-01 2.10E-02 8.36E-02
Familial hypercholesterolemia 5C80.00 Whole blood 1.39E-07 9.86E-01 1.57E+00
Gastric cancer 2B72 Gastric tissue 1.56E-02 1.30E+00 4.24E+00
Glioblastopma 2A00.00 Nervous tissue 9.72E-66 8.46E-01 1.47E+00
Glioma 2A00.0Y-2A00.0Z Brain stem tissue 8.46E-01 2.21E-01 1.66E-01
Glioma 2A00.0Y-2A00.0Z White matter tissue 3.21E-06 2.32E+00 2.73E+00
Head and neck cancer 2D42 Head and neck tissue 2.78E-05 7.38E-01 6.48E-01
HIV-associated neurocognitive impairment 8A2Y-8A2Z White matter tissue 2.10E-01 2.62E-01 7.20E-01
Huntington's disease 8A01.10 Whole blood 4.76E-02 -2.39E-01 -9.71E-01
Idiopathic pulmonary fibrosis CB03.4 Lung tissue 1.78E-01 2.56E-01 6.55E-01
Immunodeficiency 4A00-4A20 Peripheral blood 7.27E-03 2.61E-01 1.90E+00
Influenza 1E30 Whole blood 1.05E-03 -1.25E+00 -6.76E+00
Interstitial cystitis GC00.3 Bladder tissue 5.56E-01 -1.14E-01 -5.51E-01
Intracranial aneurysm 8B01.0 Intracranial artery 1.40E-03 7.38E-01 9.41E-01
Irritable bowel syndrome DD91.0 Rectal colon tissue 2.63E-02 -1.15E-01 -3.34E-01
Ischemic stroke 8B11 Peripheral blood 1.59E-01 -4.82E-01 -7.07E-01
Juvenile idiopathic arthritis FA24 Peripheral blood 5.77E-03 -1.82E-01 -4.45E-01
Lateral sclerosis 8B60.4 Skin 2.54E-01 1.37E-01 1.10E+00
Lateral sclerosis 8B60.4 Cervical spinal cord 6.43E-01 -1.27E-01 -2.99E-01
Liver cancer 2C12.0 Liver tissue 9.06E-01 7.51E-03 1.25E-02
Liver failure DB99.7-DB99.8 Liver tissue 1.38E-05 -1.66E+00 -3.43E+00
Lung cancer 2C25 Lung tissue 2.89E-27 4.42E-01 1.00E+00
Lupus erythematosus 4A40 Whole blood 3.16E-01 2.34E-01 3.26E-01
Major depressive disorder 6A70-6A7Z Hippocampus 3.94E-01 -4.08E-02 -2.21E-01
Major depressive disorder 6A70-6A7Z Whole blood 4.98E-01 -4.90E-02 -8.40E-02
Melanoma 2C30 Skin 3.52E-01 1.97E-01 3.16E-01
Multiple myeloma 2A83.1 Peripheral blood 3.52E-01 6.63E-02 1.81E-01
Multiple myeloma 2A83.1 Bone marrow 1.58E-03 6.72E-01 2.02E+00
Multiple sclerosis 8A40 Plasmacytoid dendritic cells 1.13E-02 -5.77E-01 -1.14E+00
Myelodysplastic syndrome 2A36-2A3Z Bone marrow 4.39E-02 2.23E-01 3.28E-01
Myelofibrosis 2A20.2 Whole blood 5.66E-02 8.16E-01 2.27E+00
Myocardial infarction BA41-BA50 Peripheral blood 2.20E-03 -5.86E-01 -5.08E-01
Myopathy 8C70.6 Muscle tissue 2.87E-03 5.48E-01 1.87E+00
Neonatal sepsis KA60 Whole blood 9.63E-01 -1.83E-01 -3.07E-01
Neuroectodermal tumour 2A00.11 Brain stem tissue 4.30E-08 2.91E+00 4.79E+00
Non-alcoholic fatty liver disease DB92 Liver tissue 1.53E-01 -2.36E-01 -1.02E+00
Obesity related type 2 diabetes 5A11 Omental adipose tissue 2.22E-01 -5.90E-02 -8.37E-02
Olive pollen allergy CA08.00 Peripheral blood 4.53E-01 -1.25E-01 -3.27E-01
Oral cancer 2B6E Oral tissue 1.46E-07 1.68E+00 1.58E+00
Osteoarthritis FA00-FA0Z Synovial tissue 5.27E-02 1.01E+00 1.13E+00
Osteoporosis FB83.1 Bone marrow 4.16E-04 -5.11E-01 -3.80E+00
Ovarian cancer 2C73 Ovarian tissue 1.53E-03 6.30E-01 1.66E+00
Pancreatic cancer 2C10 Pancreas 3.36E-02 5.96E-01 8.28E-01
Parkinson's disease 8A00.0 Substantia nigra tissue 2.98E-01 -2.10E-01 -4.00E-01
Pediatric respiratory syncytial virus infection CA40.11 Peripheral blood 3.80E-02 4.65E-01 1.04E+00
Pituitary cancer 2D12 Pituitary tissue 2.02E-02 3.13E-01 5.15E-01
Pituitary gonadotrope tumour 2D12 Pituitary tissue 1.46E-02 3.69E-01 8.87E-01
Polycystic ovary syndrome 5A80.1 Vastus lateralis muscle 5.89E-01 7.21E-02 3.33E-01
Polycythemia vera 2A20.4 Whole blood 3.95E-01 9.33E-02 2.71E-01
Pompe disease 5C51.3 Biceps muscle 2.39E-04 6.51E-01 3.48E+00
Preterm birth KA21.4Z Myometrium 6.26E-01 5.16E-02 6.82E-02
Prostate cancer 2C82 Prostate 1.66E-01 6.51E-01 8.84E-01
Psoriasis EA90 Skin 5.64E-15 6.97E-01 1.18E+00
Rectal cancer 2B92 Rectal colon tissue 4.61E-04 -7.25E-01 -2.63E+00
Renal cancer 2C90-2C91 Kidney 6.02E-03 8.44E-01 1.40E+00
Retinoblastoma 2D02.2 Uvea 3.94E-01 -8.33E-02 -1.66E-01
Rheumatoid arthritis FA20 Synovial tissue 8.99E-03 2.10E-01 4.09E-01
Rhinovirus infection CA42.1 Nasal epithelium tissue 7.72E-01 -2.33E-02 -8.48E-02
Schizophrenia 6A20 Prefrontal cortex 7.08E-01 7.47E-03 1.32E-02
Schizophrenia 6A20 Superior temporal cortex 6.19E-01 3.99E-02 1.14E-01
Scleroderma 4A42.Z Whole blood 5.79E-04 2.85E-01 1.87E+00
Seizure 8A60-8A6Z Whole blood 4.01E-01 2.81E-01 1.14E+00
Sensitive skin EK0Z Skin 7.57E-01 -2.11E-01 -1.01E+00
Sepsis with septic shock 1G41 Whole blood 5.05E-06 -4.76E-01 -9.15E-01
Shwachman-Diamond syndrome 3A70.0 Bone marrow 2.68E-01 4.19E-01 1.18E+00
Sickle cell disease 3A51.0-3A51.3 Peripheral blood 4.51E-01 -2.91E-02 -7.37E-02
Simpson golabi behmel syndrome LD2C Adipose tissue 5.66E-02 -2.16E-01 -1.70E+00
Sjogren's syndrome 4A43.2 Salivary gland tissue 1.35E-01 4.75E-01 2.11E+00
Skin cancer 2C30-2C3Z Skin 3.25E-04 2.90E-01 4.71E-01
Thrombocythemia 3B63 Whole blood 7.61E-01 -8.72E-02 -2.49E-01
Thrombocytopenia 3B64 Whole blood 3.93E-01 -4.69E-01 -3.41E-01
Thyroid cancer 2D10 Thyroid 3.29E-01 -2.10E-02 -5.97E-02
Tibial muscular dystrophy 8C75 Muscle tissue 1.51E-05 3.96E-01 1.59E+00
Tuberous sclerosis complex LD2D.2 Perituberal tissue 4.86E-03 -5.38E-01 -7.57E+00
Type 2 diabetes 5A11 Liver tissue 1.67E-01 1.84E-01 1.11E+00
Ureter cancer 2C92 Urothelium 7.87E-01 6.33E-02 1.51E-01
Uterine cancer 2C78 Endometrium tissue 3.52E-02 1.84E-01 2.52E-01
Vitiligo ED63.0 Skin 8.89E-01 -1.48E-01 -3.70E-01
------------------------------------------------------------------------------------
⏷ Show the Full List of DME Expression Under 107 Diseases

References

1 The human and rat forms of multiple inositol polyphosphate phosphatase: functional homology with a histidine acid phosphatase up-regulated during endochondral ossification. FEBS Lett. 1999 Jan 8;442(1):99-104.