Details of Drug-Metabolizing Enzyme (DME)

General Information of Drug-Metabolizing Enzyme (DME) (ID: DE63NYG)

DME Name Galactose mutarotase (GALM)
Synonyms Aldose 1-epimerase; Aldose 1-epimerase-like protein; Galactose mutarotase/UDP-galactose 4-epimerase protein; Galactomutarotase; Galactose mutarotase; BLOCK25; GALM
Gene Name GALM
UniProt ID
GALM_HUMAN
INTEDE ID
DME0513
3D Structure
Download
2D Sequence (FASTA)
Download
3D Structure (PDB)
Download
Gene ID
130589
EC Number EC: 5.1.3.3
Isomerase
Racemase/epimerase
Carbohydrate racemase/epimerase
EC: 5.1.3.3
Lineage Species: Homo sapiens
Kingdom: Metazoa
Phylum: Chordata
Class: Mammalia
Order: Primates
Family: Hominidae
Genus: Homo
Species: Homo sapiens
Sequence
MASVTRAVFGELPSGGGTVEKFQLQSDLLRVDIISWGCTITALEVKDRQGRASDVVLGFA
ELEGYLQKQPYFGAVIGRVANRIAKGTFKVDGKEYHLAINKEPNSLHGGVRGFDKVLWTP
RVLSNGVQFSRISPDGEEGYPGELKVWVTYTLDGGELIVNYRAQASQATPVNLTNHSYFN
LAGQASPNINDHEVTIEADTYLPVDETLIPTGEVAPVQGTAFDLRKPVELGKHLQDFHLN
GFDHNFCLKGSKEKHFCARVHHAASGRVLEVYTTQPGVQFYTGNFLDGTLKGKNGAVYPK
HSGFCLETQNWPDAVNQPRFPPVLLRPGEEYDHTTWFKFSVA
Function This enzyme converts alpha-aldose to the beta-anomer. It is active on D-glucose, L-arabinose, D-xylose, D-galactose, maltose and lactose.
KEGG Pathway
Galactose metabolism (hsa00052 )
Glycolysis / Gluconeogenesis (hsa00010 )
Metabolic pathways (hsa01100 )

Molecular Interaction Atlas (MIA) of This DME

Molecular Interaction Atlas (MIA) Jump to Detail Molecular Interaction Atlas of This DME
1 Investigative Drug(s) Metabolized by This DME
Drug Name Drug ID Indication ICD 11 Highest Status REF
Alpha-D-glucose DM1X3VQ N. A. N. A. Investigative [1]

Molecular Expression Atlas (MEA) of This DME

Molecular Expression Atlas (MEA) Jump to Detail Molecular Expression Atlas of This DME
Disease Name ICD 11 Studied Tissue p-value Fold-Change Z-score
Acute myelocytic leukaemia 2B33.1 Bone marrow 2.23E-19 -5.55E-01 -1.38E+00
Alopecia ED70 Skin from scalp 3.68E-08 3.88E-01 1.11E+00
Alzheimer's disease 8A20 Entorhinal cortex 9.39E-08 1.32E-01 6.05E-01
Ankylosing spondylitis FA92.0 Pheripheral blood 3.63E-01 -1.28E-02 -5.92E-02
Aortic stenosis BB70 Calcified aortic valve 9.33E-01 -9.98E-02 -2.86E-01
Apnea 7A40 Hyperplastic tonsil 1.18E-01 3.31E-01 1.38E+00
Arthropathy FA00-FA5Z Peripheral blood 2.80E-02 -1.98E-01 -6.48E-01
Asthma CA23 Nasal and bronchial airway 4.02E-02 9.18E-02 1.42E-01
Atopic dermatitis EA80 Skin 1.53E-03 2.69E-01 9.97E-01
Autism 6A02 Whole blood 9.49E-02 -1.63E-01 -3.99E-01
Autoimmune uveitis 9A96 Peripheral monocyte 6.61E-01 1.16E-01 7.74E-01
Autosomal dominant monocytopenia 4B04 Whole blood 6.00E-01 9.77E-02 8.05E-02
Bacterial infection of gingival 1C1H Gingival tissue 9.45E-10 2.50E-01 1.07E+00
Batten disease 5C56.1 Whole blood 6.67E-01 -6.15E-02 -5.01E-01
Behcet's disease 4A62 Peripheral blood 9.00E-01 4.40E-02 1.83E-01
Bipolar disorder 6A60-6A6Z Prefrontal cortex 2.66E-01 3.54E-02 1.31E-01
Bladder cancer 2C94 Bladder tissue 4.73E-03 -6.48E-01 -1.85E+00
Breast cancer 2C60-2C6Z Breast tissue 4.06E-12 2.34E-01 4.00E-01
Cardioembolic stroke 8B11.20 Whole blood 4.74E-03 -2.28E-01 -1.04E+00
Cervical cancer 2C77 Cervical tissue 7.35E-05 3.84E-01 1.44E+00
Childhood onset rheumatic disease FA20.Z Peripheral blood 4.44E-02 -1.99E-02 -4.82E-02
Chronic hepatitis C 1E51.1 Whole blood 2.44E-03 -4.00E-01 -1.57E+00
Chronic obstructive pulmonary disease CA22 Lung tissue 2.76E-01 -1.84E-01 -3.75E-01
Chronic obstructive pulmonary disease CA22 Small airway epithelium 1.07E-01 1.42E-01 3.61E-01
Chronic rhinosinusitis CA0A Sinus mucosa tissue 1.69E-01 -3.10E-01 -9.05E-01
Colon cancer 2B90 Colon tissue 3.69E-58 -7.32E-01 -1.93E+00
Coronary artery disease BA80-BA8Z Peripheral blood 2.02E-01 -7.34E-01 -9.81E-01
Diffuse large B-cell lymphoma 2A81 Tonsil tissue 9.19E-01 -1.08E-01 -2.02E-01
Endometriosis GA10 Endometrium tissue 4.22E-01 -1.94E-02 -3.23E-02
Familial hypercholesterolemia 5C80.00 Peripheral blood 6.71E-01 1.64E-01 6.26E-01
Familial hypercholesterolemia 5C80.00 Whole blood 3.89E-08 -4.16E-01 -1.29E+00
Gastric cancer 2B72 Gastric tissue 8.91E-02 1.41E+00 2.04E+00
Glioblastopma 2A00.00 Nervous tissue 3.50E-72 5.11E-01 1.54E+00
Glioma 2A00.0Y-2A00.0Z Brain stem tissue 3.19E-01 -7.42E-01 -1.36E+00
Glioma 2A00.0Y-2A00.0Z White matter tissue 7.47E-01 -3.67E-01 -6.69E-01
Head and neck cancer 2D42 Head and neck tissue 1.11E-09 -3.95E-01 -5.69E-01
HIV-associated neurocognitive impairment 8A2Y-8A2Z White matter tissue 1.43E-01 7.41E-02 4.87E-01
Huntington's disease 8A01.10 Whole blood 3.79E-01 3.15E-02 1.18E-01
Idiopathic pulmonary fibrosis CB03.4 Lung tissue 2.91E-02 3.33E-01 9.69E-01
Immunodeficiency 4A00-4A20 Peripheral blood 8.38E-04 3.37E-01 1.96E+00
Influenza 1E30 Whole blood 6.31E-05 8.54E-01 8.75E+00
Interstitial cystitis GC00.3 Bladder tissue 6.35E-01 4.96E-02 4.04E-01
Intracranial aneurysm 8B01.0 Intracranial artery 1.10E-02 3.67E-01 1.15E+00
Irritable bowel syndrome DD91.0 Rectal colon tissue 1.78E-04 -8.61E-02 -4.01E-01
Ischemic stroke 8B11 Peripheral blood 9.11E-01 -8.94E-02 -2.08E-01
Juvenile idiopathic arthritis FA24 Peripheral blood 5.31E-04 -1.64E-01 -3.65E-01
Lateral sclerosis 8B60.4 Skin 4.03E-01 2.14E-01 3.63E-01
Lateral sclerosis 8B60.4 Cervical spinal cord 3.38E-01 7.91E-02 2.64E-01
Liver cancer 2C12.0 Liver tissue 1.71E-02 -3.43E-01 -5.83E-01
Liver failure DB99.7-DB99.8 Liver tissue 2.32E-01 -1.39E-01 -3.64E-01
Lung cancer 2C25 Lung tissue 1.30E-01 6.74E-02 1.70E-01
Lupus erythematosus 4A40 Whole blood 2.40E-07 5.05E-01 6.70E-01
Major depressive disorder 6A70-6A7Z Hippocampus 2.18E-01 -8.55E-02 -3.13E-01
Major depressive disorder 6A70-6A7Z Whole blood 7.43E-01 2.47E-02 9.55E-02
Melanoma 2C30 Skin 4.62E-02 5.03E-01 5.90E-01
Multiple myeloma 2A83.1 Peripheral blood 9.17E-01 1.58E-01 1.71E-01
Multiple myeloma 2A83.1 Bone marrow 2.74E-01 -1.12E-01 -4.58E-01
Multiple sclerosis 8A40 Plasmacytoid dendritic cells 2.86E-01 1.76E-01 4.93E-01
Myelodysplastic syndrome 2A36-2A3Z Bone marrow 1.19E-05 1.39E-01 6.13E-01
Myelofibrosis 2A20.2 Whole blood 8.65E-01 -1.56E-01 -8.15E-01
Myocardial infarction BA41-BA50 Peripheral blood 1.44E-03 -9.32E-01 -9.61E-01
Myopathy 8C70.6 Muscle tissue 1.69E-02 1.44E-01 7.32E-01
Neonatal sepsis KA60 Whole blood 1.68E-02 -2.85E-01 -7.97E-01
Neuroectodermal tumour 2A00.11 Brain stem tissue 1.67E-04 6.41E-01 1.94E+00
Non-alcoholic fatty liver disease DB92 Liver tissue 3.53E-01 -5.61E-02 -1.26E-01
Obesity related type 2 diabetes 5A11 Omental adipose tissue 2.46E-01 9.95E-02 2.01E-01
Olive pollen allergy CA08.00 Peripheral blood 6.03E-01 8.01E-02 2.36E-01
Oral cancer 2B6E Oral tissue 6.04E-04 -3.79E-01 -1.03E+00
Osteoarthritis FA00-FA0Z Synovial tissue 5.81E-02 3.40E-01 1.35E+00
Osteoporosis FB83.1 Bone marrow 2.75E-01 2.41E-01 5.01E-01
Ovarian cancer 2C73 Ovarian tissue 6.96E-01 1.51E-02 1.74E-02
Pancreatic cancer 2C10 Pancreas 3.10E-04 5.00E-01 1.27E+00
Parkinson's disease 8A00.0 Substantia nigra tissue 7.51E-02 8.06E-02 7.89E-01
Pediatric respiratory syncytial virus infection CA40.11 Peripheral blood 1.60E-02 1.60E-01 9.04E-01
Pituitary cancer 2D12 Pituitary tissue 8.09E-01 -2.72E-02 -7.72E-02
Pituitary gonadotrope tumour 2D12 Pituitary tissue 9.00E-01 -1.25E-01 -2.98E-01
Polycystic ovary syndrome 5A80.1 Vastus lateralis muscle 5.69E-01 1.03E-02 1.28E-01
Polycythemia vera 2A20.4 Whole blood 4.10E-01 -1.04E-01 -5.45E-01
Pompe disease 5C51.3 Biceps muscle 1.93E-02 -4.87E-01 -3.04E+00
Preterm birth KA21.4Z Myometrium 7.53E-01 4.55E-02 1.31E-01
Prostate cancer 2C82 Prostate 6.35E-01 4.80E-01 8.67E-01
Psoriasis EA90 Skin 3.20E-01 2.49E-02 7.94E-02
Rectal cancer 2B92 Rectal colon tissue 5.24E-07 -9.51E-01 -5.59E+00
Renal cancer 2C90-2C91 Kidney 7.97E-03 -9.79E-01 -1.12E+00
Retinoblastoma 2D02.2 Uvea 2.87E-07 2.19E+00 7.64E+00
Rheumatoid arthritis FA20 Synovial tissue 3.21E-13 8.09E-01 6.98E+00
Rhinovirus infection CA42.1 Nasal epithelium tissue 3.05E-01 6.33E-02 1.76E-01
Schizophrenia 6A20 Prefrontal cortex 8.84E-02 8.89E-02 1.32E-01
Schizophrenia 6A20 Superior temporal cortex 4.10E-01 6.36E-02 5.24E-01
Scleroderma 4A42.Z Whole blood 7.83E-01 -7.91E-02 -2.94E-01
Seizure 8A60-8A6Z Whole blood 3.04E-01 5.42E-01 5.83E-01
Sensitive skin EK0Z Skin 3.83E-01 -5.86E-02 -2.76E-01
Sepsis with septic shock 1G41 Whole blood 1.35E-01 -8.24E-02 -2.25E-01
Shwachman-Diamond syndrome 3A70.0 Bone marrow 6.55E-01 -1.03E-01 -4.72E-01
Sickle cell disease 3A51.0-3A51.3 Peripheral blood 1.09E-01 4.05E-01 1.19E+00
Simpson golabi behmel syndrome LD2C Adipose tissue 8.56E-01 -3.67E-01 -8.14E-01
Sjogren's syndrome 4A43.2 Salivary gland tissue 4.64E-01 -2.95E-01 -5.01E-01
Skin cancer 2C30-2C3Z Skin 3.44E-15 5.17E-01 1.24E+00
Thrombocythemia 3B63 Whole blood 6.01E-01 -1.27E-01 -6.86E-01
Thrombocytopenia 3B64 Whole blood 9.04E-01 1.21E-01 5.39E-01
Thyroid cancer 2D10 Thyroid 2.16E-03 -1.51E-01 -4.60E-01
Tibial muscular dystrophy 8C75 Muscle tissue 4.58E-04 2.27E-01 1.45E+00
Tuberous sclerosis complex LD2D.2 Perituberal tissue 1.67E-01 4.19E-01 1.35E+00
Type 2 diabetes 5A11 Liver tissue 3.63E-01 -3.57E-01 -9.47E-01
Ureter cancer 2C92 Urothelium 3.27E-01 9.33E-02 4.68E-01
Uterine cancer 2C78 Endometrium tissue 3.70E-11 4.87E-01 8.73E-01
Vitiligo ED63.0 Skin 7.19E-01 1.69E-02 1.02E-01
------------------------------------------------------------------------------------
⏷ Show the Full List of DME Expression Under 107 Diseases

References

1 Identification and characterisation of human aldose 1-epimerase. FEBS Lett. 2003 May 22;543(1-3):21-4.