Details of Drug-Metabolizing Enzyme (DME)

General Information of Drug-Metabolizing Enzyme (DME) (ID: DE6NMGO)

DME Name Cytochrome P450 2S1 (CYP2S1)
Synonyms Cytochrome P450 family 2 subfamily S member 1; Thromboxane-A synthase; CYP2S1; CYPIIS1; UNQ891/PRO1906
Gene Name CYP2S1
UniProt ID
CP2S1_HUMAN
INTEDE ID
DME0033
3D Structure
Download
2D Sequence (FASTA)
Download
3D Structure (PDB)
Download
Gene ID
29785
EC Number EC: 1.14.14.1
Oxidoreductase
Oxygen paired donor oxidoreductase
Flavin/flavoprotein donor oxidoreductase
EC: 1.14.14.1
Lineage Species: Homo sapiens
Kingdom: Metazoa
Phylum: Chordata
Class: Mammalia
Order: Primates
Family: Hominidae
Genus: Homo
Species: Homo sapiens
Sequence
MEATGTWALLLALALLLLLTLALSGTRARGHLPPGPTPLPLLGNLLQLRPGALYSGLMRL
SKKYGPVFTIYLGPWRPVVVLVGQEAVREALGGQAEEFSGRGTVAMLEGTFDGHGVFFSN
GERWRQLRKFTMLALRDLGMGKREGEELIQAEARCLVETFQGTEGRPFDPSLLLAQATSN
VVCSLLFGLRFSYEDKEFQAVVRAAGGTLLGVSSQGGQTYEMFSWFLRPLPGPHKQLLHH
VSTLAAFTVRQVQQHQGNLDASGPARDLVDAFLLKMAQEEQNPGTEFTNKNMLMTVIYLL
FAGTMTVSTTVGYTLLLLMKYPHVQKWVREELNRELGAGQAPSLGDRTRLPYTDAVLHEA
QRLLALVPMGIPRTLMRTTRFRGYTLPQGTEVFPLLGSILHDPNIFKHPEEFNPDRFLDA
DGRFRKHEAFLPFSLGKRVCLGEGLAKAELFLFFTTILQAFSLESPCPPDTLSLKPTVSG
LFNIPPAFQLQVRPTDLHSTTQTR
Function
This enzyme is involved in the metabolism of retinoids and eicosanoids. In epidermis, it may contribute to the oxidative metabolism of all-trans- retinoic acid. Additionally, it displays peroxidase and isomerase activities toward various oxygenated eicosanoids such as prostaglandin H2 (PGH2) and hydroperoxyeicosatetraenoates (HPETEs).
KEGG Pathway
Metabolic pathways (hsa01100 )
Metabolism of xenobiotics by cytochrome P450 (hsa00980 )
Retinol metabolism (hsa00830 )
Reactome Pathway
Miscellaneous substrates (R-HSA-211958 )
Xenobiotics (R-HSA-211981 )
CYP2E1 reactions (R-HSA-211999 )

Molecular Interaction Atlas (MIA) of This DME

Molecular Interaction Atlas (MIA) Jump to Detail Molecular Interaction Atlas of This DME
1 Approved Drug(s) Metabolized by This DME
Drug Name Drug ID Indication ICD 11 Highest Status REF
Vitamin A DMJ2AH4 Night blindness 9D45 Approved [1]

Molecular Expression Atlas (MEA) of This DME

Molecular Expression Atlas (MEA) Jump to Detail Molecular Expression Atlas of This DME
Disease Name ICD 11 Studied Tissue p-value Fold-Change Z-score
Acute myelocytic leukaemia 2B33.1 Bone marrow 2.54E-08 2.22E-02 9.29E-02
Alopecia ED70 Skin from scalp 3.29E-01 5.82E-02 2.91E-01
Alzheimer's disease 8A20 Entorhinal cortex 8.68E-03 9.56E-02 5.42E-01
Ankylosing spondylitis FA92.0 Pheripheral blood 3.26E-01 2.12E-02 7.10E-02
Aortic stenosis BB70 Calcified aortic valve 9.99E-01 8.66E-02 1.49E-01
Apnea 7A40 Hyperplastic tonsil 6.75E-01 1.17E-01 5.32E-01
Arthropathy FA00-FA5Z Peripheral blood 1.43E-01 -2.66E-02 -9.13E-02
Asthma CA23 Nasal and bronchial airway 1.37E-01 -5.72E-02 -8.46E-02
Atopic dermatitis EA80 Skin 1.31E-08 3.90E-01 3.15E+00
Autism 6A02 Whole blood 7.30E-01 2.32E-04 9.73E-04
Autoimmune uveitis 9A96 Peripheral monocyte 3.55E-01 7.33E-02 1.52E-01
Autosomal dominant monocytopenia 4B04 Whole blood 2.51E-01 -6.95E-02 -3.57E-01
Bacterial infection of gingival 1C1H Gingival tissue 1.21E-01 1.51E-01 2.45E-01
Batten disease 5C56.1 Whole blood 8.35E-01 8.54E-02 2.68E-01
Behcet's disease 4A62 Peripheral blood 9.35E-01 9.60E-02 1.89E-01
Bipolar disorder 6A60-6A6Z Prefrontal cortex 4.09E-01 6.96E-02 3.89E-01
Bladder cancer 2C94 Bladder tissue 6.92E-01 2.78E-01 4.77E-01
Breast cancer 2C60-2C6Z Breast tissue 1.45E-01 2.72E-02 7.09E-02
Cardioembolic stroke 8B11.20 Whole blood 3.77E-01 1.08E-02 4.87E-02
Cervical cancer 2C77 Cervical tissue 1.85E-03 1.32E-01 3.15E-01
Childhood onset rheumatic disease FA20.Z Peripheral blood 1.02E-01 7.31E-02 2.76E-01
Chronic hepatitis C 1E51.1 Whole blood 9.74E-01 -3.76E-02 -1.14E-01
Chronic obstructive pulmonary disease CA22 Lung tissue 7.28E-01 -7.92E-04 -2.23E-03
Chronic obstructive pulmonary disease CA22 Small airway epithelium 2.28E-01 -9.30E-02 -1.13E-01
Chronic rhinosinusitis CA0A Sinus mucosa tissue 7.32E-01 -3.19E-01 -3.39E-01
Colon cancer 2B90 Colon tissue 7.39E-01 2.28E-01 2.95E-01
Coronary artery disease BA80-BA8Z Peripheral blood 4.26E-01 1.11E-01 6.69E-01
Diffuse large B-cell lymphoma 2A81 Tonsil tissue 4.08E-01 4.05E-02 1.64E-01
Endometriosis GA10 Endometrium tissue 2.70E-01 1.01E-01 1.06E-01
Familial hypercholesterolemia 5C80.00 Peripheral blood 7.15E-02 -1.53E-01 -9.02E-01
Familial hypercholesterolemia 5C80.00 Whole blood 8.50E-05 8.79E-01 1.73E+00
Gastric cancer 2B72 Gastric tissue 4.82E-01 -2.01E+00 -9.43E-01
Glioblastopma 2A00.00 Nervous tissue 1.44E-17 -1.74E-01 -4.72E-01
Glioma 2A00.0Y-2A00.0Z Brain stem tissue 7.15E-02 -3.96E-01 -3.36E+00
Glioma 2A00.0Y-2A00.0Z White matter tissue 8.54E-06 -4.45E-01 -2.56E+00
Head and neck cancer 2D42 Head and neck tissue 3.40E-11 -8.08E-01 -9.49E-01
HIV-associated neurocognitive impairment 8A2Y-8A2Z White matter tissue 8.97E-02 -9.10E-02 -3.22E-01
Huntington's disease 8A01.10 Whole blood 3.49E-01 1.05E-01 2.86E-01
Idiopathic pulmonary fibrosis CB03.4 Lung tissue 7.41E-05 1.12E+00 3.81E+00
Immunodeficiency 4A00-4A20 Peripheral blood 4.43E-02 7.25E-02 8.18E-01
Influenza 1E30 Whole blood 2.00E-01 -5.07E-01 -1.02E+00
Interstitial cystitis GC00.3 Bladder tissue 7.69E-01 1.43E-01 2.36E-01
Intracranial aneurysm 8B01.0 Intracranial artery 2.28E-02 1.95E-01 1.28E+00
Irritable bowel syndrome DD91.0 Rectal colon tissue 2.61E-02 -2.77E-01 -4.78E-01
Ischemic stroke 8B11 Peripheral blood 1.88E-01 -3.72E-01 -8.86E-01
Juvenile idiopathic arthritis FA24 Peripheral blood 8.08E-01 4.55E-03 1.77E-02
Lateral sclerosis 8B60.4 Skin 8.22E-01 7.83E-02 3.21E-01
Lateral sclerosis 8B60.4 Cervical spinal cord 5.86E-01 1.25E-01 4.37E-01
Liver cancer 2C12.0 Liver tissue 6.13E-01 -1.46E-01 -4.61E-01
Liver failure DB99.7-DB99.8 Liver tissue 1.37E-01 9.43E-02 3.93E-01
Lung cancer 2C25 Lung tissue 4.03E-01 -2.88E-01 -5.59E-01
Lupus erythematosus 4A40 Whole blood 3.57E-01 -3.09E-03 -8.67E-03
Major depressive disorder 6A70-6A7Z Hippocampus 2.09E-01 5.56E-02 3.35E-01
Major depressive disorder 6A70-6A7Z Whole blood 3.88E-01 1.43E-02 7.00E-02
Melanoma 2C30 Skin 5.53E-01 5.74E-02 1.11E-01
Multiple myeloma 2A83.1 Peripheral blood 9.68E-01 2.74E-02 1.10E-01
Multiple myeloma 2A83.1 Bone marrow 2.59E-05 -7.28E-01 -2.99E+00
Multiple sclerosis 8A40 Plasmacytoid dendritic cells 2.37E-01 3.03E-01 8.41E-01
Myelodysplastic syndrome 2A36-2A3Z Bone marrow 7.16E-01 -5.42E-02 -3.12E-01
Myelofibrosis 2A20.2 Whole blood 1.05E-01 -2.42E-01 -1.45E+00
Myocardial infarction BA41-BA50 Peripheral blood 6.05E-03 1.43E-01 4.41E-01
Myopathy 8C70.6 Muscle tissue 4.06E-01 -1.62E-01 -5.64E-01
Neonatal sepsis KA60 Whole blood 7.90E-01 1.64E-02 5.10E-02
Neuroectodermal tumour 2A00.11 Brain stem tissue 7.25E-05 -9.30E-01 -2.50E+00
Non-alcoholic fatty liver disease DB92 Liver tissue 4.34E-01 -1.28E-01 -8.25E-01
Obesity related type 2 diabetes 5A11 Omental adipose tissue 1.63E-01 1.70E-01 1.79E+00
Olive pollen allergy CA08.00 Peripheral blood 2.98E-01 2.39E-01 9.78E-01
Oral cancer 2B6E Oral tissue 6.66E-01 -2.98E-01 -4.55E-01
Osteoarthritis FA00-FA0Z Synovial tissue 5.75E-01 4.60E-02 1.95E-01
Osteoporosis FB83.1 Bone marrow 6.72E-01 3.32E-02 2.44E-01
Ovarian cancer 2C73 Ovarian tissue 1.06E-03 6.39E-01 1.31E+00
Pancreatic cancer 2C10 Pancreas 3.60E-08 9.41E-01 1.88E+00
Parkinson's disease 8A00.0 Substantia nigra tissue 2.49E-02 -4.84E-01 -8.29E-01
Pediatric respiratory syncytial virus infection CA40.11 Peripheral blood 6.01E-01 -3.76E-02 -1.71E-01
Pituitary cancer 2D12 Pituitary tissue 3.19E-06 6.45E-01 2.53E+00
Pituitary gonadotrope tumour 2D12 Pituitary tissue 3.99E-05 8.34E-01 2.83E+00
Polycystic ovary syndrome 5A80.1 Vastus lateralis muscle 3.87E-03 -2.04E-01 -1.20E+00
Polycythemia vera 2A20.4 Whole blood 1.05E-04 -7.92E-02 -3.88E-01
Pompe disease 5C51.3 Biceps muscle 2.54E-01 -1.10E-01 -4.16E-01
Preterm birth KA21.4Z Myometrium 4.96E-01 -1.35E-02 -9.75E-02
Prostate cancer 2C82 Prostate 1.29E-01 -3.58E-01 -7.51E-01
Psoriasis EA90 Skin 2.61E-09 3.87E-01 9.25E-01
Rectal cancer 2B92 Rectal colon tissue 7.06E-01 1.93E-02 5.37E-02
Renal cancer 2C90-2C91 Kidney 1.12E-01 -3.02E-01 -8.29E-01
Retinoblastoma 2D02.2 Uvea 3.13E-06 -6.67E-01 -2.33E+00
Rheumatoid arthritis FA20 Synovial tissue 1.41E-04 6.99E-01 2.71E+00
Rhinovirus infection CA42.1 Nasal epithelium tissue 1.42E-01 -1.50E-01 -3.09E-01
Schizophrenia 6A20 Prefrontal cortex 1.99E-02 5.19E-02 1.26E-01
Schizophrenia 6A20 Superior temporal cortex 4.71E-01 -3.56E-02 -1.78E-01
Scleroderma 4A42.Z Whole blood 8.79E-02 -1.64E-01 -6.65E-01
Seizure 8A60-8A6Z Whole blood 3.07E-01 -1.21E-01 -5.47E-01
Sensitive skin EK0Z Skin 8.96E-01 -6.11E-02 -2.55E-01
Sepsis with septic shock 1G41 Whole blood 5.41E-01 1.86E-02 5.35E-02
Shwachman-Diamond syndrome 3A70.0 Bone marrow 2.16E-01 1.57E-01 9.07E-01
Sickle cell disease 3A51.0-3A51.3 Peripheral blood 5.97E-02 1.07E-01 4.05E-01
Simpson golabi behmel syndrome LD2C Adipose tissue 4.76E-01 -1.06E-01 -3.55E-01
Sjogren's syndrome 4A43.2 Salivary gland tissue 8.47E-01 -1.76E-02 -7.28E-02
Skin cancer 2C30-2C3Z Skin 1.99E-02 -1.31E-01 -3.33E-01
Thrombocythemia 3B63 Whole blood 3.03E-02 -9.33E-02 -5.16E-01
Thrombocytopenia 3B64 Whole blood 4.82E-01 3.67E-01 6.38E-01
Thyroid cancer 2D10 Thyroid 1.16E-35 6.39E-01 2.01E+00
Tibial muscular dystrophy 8C75 Muscle tissue 8.67E-01 -6.71E-02 -2.29E-01
Tuberous sclerosis complex LD2D.2 Perituberal tissue 9.72E-02 1.80E-01 1.00E+00
Type 2 diabetes 5A11 Liver tissue 1.65E-01 1.52E-01 9.17E-01
Ureter cancer 2C92 Urothelium 3.30E-01 -6.57E-02 -4.11E-01
Uterine cancer 2C78 Endometrium tissue 5.36E-13 2.19E-01 5.24E-01
Vitiligo ED63.0 Skin 5.25E-01 3.83E-03 1.22E-02
------------------------------------------------------------------------------------
⏷ Show the Full List of DME Expression Under 107 Diseases

References

1 The involvement of cytochrome p450 (CYP) 26 in the retinoic acid metabolism of human epidermal keratinocytes. Biochim Biophys Acta. 2009 Mar;1791(3):220-8.