Details of Drug-Metabolizing Enzyme (DME)

General Information of Drug-Metabolizing Enzyme (DME) (ID: DE6QH2D)

DME Name MOSC domain-containing protein 2 (MARC2)
Synonyms Moco sulfurase C-terminal domain-containing protein 2; Molybdenum cofactor sulfurase C-terminal domain-containing protein 2; Mitochondrial amidoxime reducing component 2; MARC2; MOSC2; MTARC2
Gene Name MTARC2
UniProt ID
MARC2_HUMAN
INTEDE ID
DME0541
3D Structure
Download
2D Sequence (FASTA)
Download
3D Structure (PDB)
Download
Gene ID
54996
EC Number EC: 1.7.2.1
Oxidoreductase
Cytochrome acceptor oxidoreductase
Cytochrome acceptor oxidoreductase
EC: 1.7.2.1
Lineage Species: Homo sapiens
Kingdom: Metazoa
Phylum: Chordata
Class: Mammalia
Order: Primates
Family: Hominidae
Genus: Homo
Species: Homo sapiens
Sequence
MGASSSSALARLGLPARPWPRWLGVAALGLAAVALGTVAWRRAWPRRRRRLQQVGTVAKL
WIYPVKSCKGVPVSEAECTAMGLRSGNLRDRFWLVIKEDGHMVTARQEPRLVLISIIYEN
NCLIFRAPDMDQLVLPSKQPSSNKLHNCRIFGLDIKGRDCGNEAAKWFTNFLKTEAYRLV
QFETNMKGRTSRKLLPTLDQNFQVAYPDYCPLLIMTDASLVDLNTRMEKKMKMENFRPNI
VVTGCDAFEEDTWDELLIGSVEVKKVMACPRCILTTVDPDTGVIDRKQPLDTLKSYRLCD
PSERELYKLSPLFGIYYSVEKIGSLRVGDPVYRMV
Function
This enzyme catalyzes the reduction of N-oxygenated molecules, acting as a counterpart of cytochrome P450 and flavin-containing monooxygenases in metabolic cycles. As a component of prodrug-converting system, it reduces a multitude of N-hydroxylated prodrugs particularly amidoximes, leading to increased drug bioavailability.
Reactome Pathway
Phase I - Functionalization of compounds (R-HSA-211945 )

Molecular Interaction Atlas (MIA) of This DME

Molecular Interaction Atlas (MIA) Jump to Detail Molecular Interaction Atlas of This DME
1 Investigative Drug(s) Metabolized by This DME
Drug Name Drug ID Indication ICD 11 Highest Status REF
Nitrite DMR5XT3 N. A. N. A. Investigative [1]

Molecular Expression Atlas (MEA) of This DME

Molecular Expression Atlas (MEA) Jump to Detail Molecular Expression Atlas of This DME
Disease Name ICD 11 Studied Tissue p-value Fold-Change Z-score
Acute myelocytic leukaemia 2B33.1 Bone marrow 1.89E-10 3.94E-02 1.56E-01
Alopecia ED70 Skin from scalp 3.54E-03 2.05E-01 6.56E-01
Alzheimer's disease 8A20 Entorhinal cortex 2.26E-02 -1.43E-01 -4.20E-01
Ankylosing spondylitis FA92.0 Pheripheral blood 3.40E-01 -1.62E-01 -3.34E-01
Aortic stenosis BB70 Calcified aortic valve 7.27E-01 -2.45E-01 -2.28E-01
Apnea 7A40 Hyperplastic tonsil 4.54E-02 1.33E+00 7.53E+00
Arthropathy FA00-FA5Z Peripheral blood 7.19E-01 -3.45E-02 -2.13E-01
Asthma CA23 Nasal and bronchial airway 3.97E-07 -3.80E-01 -6.02E-01
Atopic dermatitis EA80 Skin 5.67E-02 -2.90E-01 -9.20E-01
Autism 6A02 Whole blood 8.28E-01 -5.56E-03 -3.96E-02
Autoimmune uveitis 9A96 Peripheral monocyte 6.37E-02 -1.74E-01 -1.76E+00
Autosomal dominant monocytopenia 4B04 Whole blood 3.96E-02 8.81E-02 9.50E-01
Bacterial infection of gingival 1C1H Gingival tissue 4.68E-08 2.72E-01 1.02E+00
Batten disease 5C56.1 Whole blood 4.12E-01 1.63E-02 8.95E-02
Behcet's disease 4A62 Peripheral blood 8.18E-01 3.63E-02 2.46E-01
Bipolar disorder 6A60-6A6Z Prefrontal cortex 8.66E-02 2.45E-01 6.24E-01
Bladder cancer 2C94 Bladder tissue 1.11E-09 -9.74E-01 -6.44E+00
Breast cancer 2C60-2C6Z Breast tissue 2.31E-33 -7.17E-01 -9.54E-01
Cardioembolic stroke 8B11.20 Whole blood 1.37E-02 1.85E-01 4.70E-01
Cervical cancer 2C77 Cervical tissue 3.06E-01 -2.16E-01 -3.92E-01
Childhood onset rheumatic disease FA20.Z Peripheral blood 4.76E-01 -1.87E-02 -1.06E-01
Chronic hepatitis C 1E51.1 Whole blood 2.53E-01 9.07E-02 6.25E-01
Chronic obstructive pulmonary disease CA22 Lung tissue 1.95E-03 -2.92E-01 -1.08E+00
Chronic obstructive pulmonary disease CA22 Small airway epithelium 6.64E-01 -4.38E-02 -1.03E-01
Chronic rhinosinusitis CA0A Sinus mucosa tissue 9.37E-03 -4.39E-01 -2.07E+00
Colon cancer 2B90 Colon tissue 1.45E-43 -6.25E-01 -1.53E+00
Coronary artery disease BA80-BA8Z Peripheral blood 1.56E-01 -2.84E-01 -1.27E+00
Diffuse large B-cell lymphoma 2A81 Tonsil tissue 7.40E-01 -2.39E-01 -2.06E-01
Endometriosis GA10 Endometrium tissue 2.33E-01 -9.81E-02 -2.46E-01
Familial hypercholesterolemia 5C80.00 Peripheral blood 2.32E-01 1.28E-01 4.91E-01
Familial hypercholesterolemia 5C80.00 Whole blood 7.20E-02 -1.37E-01 -7.90E-01
Gastric cancer 2B72 Gastric tissue 2.26E-01 -8.21E-01 -8.05E-01
Glioblastopma 2A00.00 Nervous tissue 1.96E-11 -3.42E-01 -6.72E-01
Glioma 2A00.0Y-2A00.0Z Brain stem tissue 8.35E-03 7.61E-01 4.21E+00
Glioma 2A00.0Y-2A00.0Z White matter tissue 2.97E-01 5.72E-02 8.53E-02
Head and neck cancer 2D42 Head and neck tissue 7.06E-25 -7.94E-01 -1.55E+00
HIV-associated neurocognitive impairment 8A2Y-8A2Z White matter tissue 6.02E-01 2.44E-01 5.40E-01
Huntington's disease 8A01.10 Whole blood 8.18E-01 -1.95E-02 -1.99E-01
Idiopathic pulmonary fibrosis CB03.4 Lung tissue 2.80E-01 -9.93E-02 -2.85E-01
Immunodeficiency 4A00-4A20 Peripheral blood 5.42E-02 1.04E-01 1.23E+00
Influenza 1E30 Whole blood 1.20E-01 3.57E-01 1.43E+00
Interstitial cystitis GC00.3 Bladder tissue 8.12E-01 4.13E-02 1.62E-01
Intracranial aneurysm 8B01.0 Intracranial artery 3.10E-03 -1.04E+00 -2.45E+00
Irritable bowel syndrome DD91.0 Rectal colon tissue 4.95E-05 -1.15E-01 -6.47E-01
Ischemic stroke 8B11 Peripheral blood 1.37E-01 1.66E-01 6.67E-01
Juvenile idiopathic arthritis FA24 Peripheral blood 4.07E-01 7.84E-02 2.21E-01
Lateral sclerosis 8B60.4 Skin 9.89E-01 1.21E-02 2.48E-02
Lateral sclerosis 8B60.4 Cervical spinal cord 5.20E-01 6.29E-02 2.08E-01
Liver cancer 2C12.0 Liver tissue 9.64E-28 -9.98E-01 -2.38E+00
Liver failure DB99.7-DB99.8 Liver tissue 8.30E-09 -3.11E+00 -6.17E+00
Lung cancer 2C25 Lung tissue 7.56E-164 -1.60E+00 -4.39E+00
Lupus erythematosus 4A40 Whole blood 1.53E-01 -8.76E-02 -1.61E-01
Major depressive disorder 6A70-6A7Z Hippocampus 5.36E-01 1.17E-02 3.14E-02
Major depressive disorder 6A70-6A7Z Whole blood 3.13E-01 2.92E-02 9.42E-02
Melanoma 2C30 Skin 4.40E-04 -8.05E-01 -9.50E-01
Multiple myeloma 2A83.1 Peripheral blood 3.48E-01 -4.34E-02 -1.87E-01
Multiple myeloma 2A83.1 Bone marrow 2.42E-01 -4.25E-02 -2.14E-01
Multiple sclerosis 8A40 Plasmacytoid dendritic cells 8.27E-01 -5.04E-02 -4.36E-01
Myelodysplastic syndrome 2A36-2A3Z Bone marrow 3.96E-20 2.32E-01 1.30E+00
Myelofibrosis 2A20.2 Whole blood 1.11E-02 1.65E-01 8.83E-01
Myocardial infarction BA41-BA50 Peripheral blood 8.76E-01 -1.06E-01 -1.39E-01
Myopathy 8C70.6 Muscle tissue 1.52E-06 -7.86E-01 -4.73E+00
Neonatal sepsis KA60 Whole blood 3.52E-11 2.10E-01 9.15E-01
Neuroectodermal tumour 2A00.11 Brain stem tissue 1.58E-02 3.26E-01 9.21E-01
Non-alcoholic fatty liver disease DB92 Liver tissue 1.19E-01 3.11E-01 7.79E-01
Obesity related type 2 diabetes 5A11 Omental adipose tissue 3.11E-01 1.66E-01 2.65E-01
Olive pollen allergy CA08.00 Peripheral blood 5.16E-01 1.76E-01 4.96E-01
Oral cancer 2B6E Oral tissue 7.29E-05 -5.50E-01 -9.06E-01
Osteoarthritis FA00-FA0Z Synovial tissue 2.11E-01 1.03E-01 1.91E-01
Osteoporosis FB83.1 Bone marrow 6.43E-01 1.22E-01 2.95E-01
Ovarian cancer 2C73 Ovarian tissue 2.86E-04 -1.35E+00 -2.53E+00
Pancreatic cancer 2C10 Pancreas 3.40E-01 -1.61E-01 -4.39E-01
Parkinson's disease 8A00.0 Substantia nigra tissue 4.34E-01 -2.41E-01 -9.78E-01
Pediatric respiratory syncytial virus infection CA40.11 Peripheral blood 2.22E-01 9.66E-02 6.25E-01
Pituitary cancer 2D12 Pituitary tissue 3.68E-06 1.49E+00 2.57E+00
Pituitary gonadotrope tumour 2D12 Pituitary tissue 1.26E-06 1.44E+00 2.77E+00
Polycystic ovary syndrome 5A80.1 Vastus lateralis muscle 3.12E-01 -1.67E-01 -6.40E-01
Polycythemia vera 2A20.4 Whole blood 3.76E-08 1.61E-01 1.06E+00
Pompe disease 5C51.3 Biceps muscle 9.12E-04 -8.89E-01 -4.63E+00
Preterm birth KA21.4Z Myometrium 5.38E-01 1.27E-01 5.63E-01
Prostate cancer 2C82 Prostate 1.91E-03 5.26E-01 1.15E+00
Psoriasis EA90 Skin 1.39E-14 -4.44E-01 -1.08E+00
Rectal cancer 2B92 Rectal colon tissue 6.95E-08 -1.22E+00 -6.50E+00
Renal cancer 2C90-2C91 Kidney 1.09E-02 -7.04E-01 -8.43E-01
Retinoblastoma 2D02.2 Uvea 2.50E-03 8.60E-01 4.55E+00
Rheumatoid arthritis FA20 Synovial tissue 1.56E-02 -8.58E-01 -1.09E+00
Rhinovirus infection CA42.1 Nasal epithelium tissue 8.71E-01 5.50E-02 3.07E-01
Schizophrenia 6A20 Prefrontal cortex 8.94E-02 -1.74E-01 -2.30E-01
Schizophrenia 6A20 Superior temporal cortex 9.51E-01 -5.83E-02 -2.33E-01
Scleroderma 4A42.Z Whole blood 6.75E-01 3.64E-02 2.74E-01
Seizure 8A60-8A6Z Whole blood 6.82E-01 3.23E-02 1.77E-01
Sensitive skin EK0Z Skin 8.58E-02 -2.68E-01 -1.34E+00
Sepsis with septic shock 1G41 Whole blood 6.43E-04 9.66E-02 3.63E-01
Shwachman-Diamond syndrome 3A70.0 Bone marrow 1.82E-01 2.56E-01 6.48E-01
Sickle cell disease 3A51.0-3A51.3 Peripheral blood 8.70E-01 7.88E-02 7.02E-01
Simpson golabi behmel syndrome LD2C Adipose tissue 1.45E-01 -7.40E-02 -1.70E+00
Sjogren's syndrome 4A43.2 Salivary gland tissue 1.40E-01 3.77E-01 1.59E+00
Skin cancer 2C30-2C3Z Skin 7.05E-05 -3.02E-01 -5.51E-01
Thrombocythemia 3B63 Whole blood 2.73E-05 1.15E-01 6.59E-01
Thrombocytopenia 3B64 Whole blood 6.72E-01 5.52E-01 8.50E-01
Thyroid cancer 2D10 Thyroid 5.83E-57 -1.57E+00 -3.02E+00
Tibial muscular dystrophy 8C75 Muscle tissue 6.25E-02 -1.78E-01 -3.99E-01
Tuberous sclerosis complex LD2D.2 Perituberal tissue 2.20E-01 -2.77E-01 -1.67E+00
Type 2 diabetes 5A11 Liver tissue 5.38E-01 -3.84E-02 -2.21E-01
Ureter cancer 2C92 Urothelium 8.68E-01 -2.15E-02 -2.20E-01
Uterine cancer 2C78 Endometrium tissue 1.78E-06 2.27E-01 3.98E-01
Vitiligo ED63.0 Skin 2.11E-01 -3.02E-01 -1.09E+00
------------------------------------------------------------------------------------
⏷ Show the Full List of DME Expression Under 107 Diseases

References

1 Nitrite reductase and nitric-oxide synthase activity of the mitochondrial molybdopterin enzymes mARC1 and mARC2. J Biol Chem. 2014 Apr 11;289(15):10345-58.