Details of Drug-Metabolizing Enzyme (DME)

General Information of Drug-Metabolizing Enzyme (DME) (ID: DE6WXTH)

DME Name Phospholipid phosphatase 1 (PLPP1)
Synonyms Lipid phosphate phosphohydrolase 1; Phosphatidate phosphohydrolase type 2a; Phosphatidic acid phosphatase 2a; LPP1; PAP-2a; PAP2-alpha; PAP2a; PLPP1; PPAP2A
Gene Name PLPP1
UniProt ID
PLPP1_HUMAN
INTEDE ID
DME0444
3D Structure
Download
2D Sequence (FASTA)
Download
3D Structure (PDB)
Download
Gene ID
8611
EC Number EC: 3.1.3.4
Hydrolases
Ester bond hydrolase
Carboxylic ester hydrolase
EC: 3.1.3.4
Lineage Species: Homo sapiens
Kingdom: Metazoa
Phylum: Chordata
Class: Mammalia
Order: Primates
Family: Hominidae
Genus: Homo
Species: Homo sapiens
Sequence
MFDKTRLPYVALDVLCVLLAGLPFAILTSRHTPFQRGVFCNDESIKYPYKEDTIPYALLG
GIIIPFSIIVIILGETLSVYCNLLHSNSFIRNNYIATIYKAIGTFLFGAAASQSLTDIAK
YSIGRLRPHFLDVCDPDWSKINCSDGYIEYYICRGNAERVKEGRLSFYSGHSSFSMYCML
FVALYLQARMKGDWARLLRPTLQFGLVAVSIYVGLSRVSDYKHHWSDVLTGLIQGALVAI
LVAVYVSDFFKERTSFKERKEEDSHTTLHETPTTGNHYPSNHQP
Function
This enzyme dephosphorylates exogenous bioactive glycerolipids and sphingolipids. It catalyzes the conversion of phosphatidic acid (PA) to diacylglycerol(DG). The relative catalytic efficiency is LPA > PA > S-1-P > C-1-P.
KEGG Pathway
Choline metabolism in cancer (hsa05231 )
Ether lipid metabolism (hsa00565 )
Fat digestion and absorption (hsa04975 )
Fc gamma R-mediated phagocytosis (hsa04666 )
Glycerolipid metabolism (hsa00561 )
Glycerophospholipid metabolism (hsa00564 )
Metabolic pathways (hsa01100 )
Phospholipase D signaling pathway (hsa04072 )
Sphingolipid metabolism (hsa00600 )
Reactome Pathway
Sphingolipid de novo biosynthesis (R-HSA-1660661 )

Molecular Interaction Atlas (MIA) of This DME

Molecular Interaction Atlas (MIA) Jump to Detail Molecular Interaction Atlas of This DME
1 Clinical Trial Drug(s) Metabolized by This DME
Drug Name Drug ID Indication ICD 11 Highest Status REF
Sphingosine-1-phosphate DMJCQKA Acne vulgaris ED80 Phase 1 [1]

Molecular Expression Atlas (MEA) of This DME

Molecular Expression Atlas (MEA) Jump to Detail Molecular Expression Atlas of This DME
Disease Name ICD 11 Studied Tissue p-value Fold-Change Z-score
Acute myelocytic leukaemia 2B33.1 Bone marrow 6.16E-12 2.20E-01 5.69E-01
Alopecia ED70 Skin from scalp 4.54E-01 2.60E-02 1.12E-01
Alzheimer's disease 8A20 Entorhinal cortex 2.44E-08 2.96E-01 9.54E-01
Ankylosing spondylitis FA92.0 Pheripheral blood 7.07E-01 5.19E-02 1.72E-01
Aortic stenosis BB70 Calcified aortic valve 8.23E-01 3.87E-01 3.79E-01
Apnea 7A40 Hyperplastic tonsil 1.47E-01 -5.82E-01 -1.73E+00
Arthropathy FA00-FA5Z Peripheral blood 1.01E-01 -3.07E-01 -1.17E+00
Asthma CA23 Nasal and bronchial airway 1.10E-05 1.09E+00 1.26E+00
Atopic dermatitis EA80 Skin 3.01E-06 -4.01E-01 -2.28E+00
Autism 6A02 Whole blood 7.95E-01 -9.27E-02 -2.94E-01
Autoimmune uveitis 9A96 Peripheral monocyte 3.35E-01 9.30E-02 4.81E-01
Autosomal dominant monocytopenia 4B04 Whole blood 4.13E-02 3.20E-01 1.41E+00
Bacterial infection of gingival 1C1H Gingival tissue 3.38E-05 3.27E-01 8.78E-01
Batten disease 5C56.1 Whole blood 8.87E-01 1.01E-01 5.09E-01
Behcet's disease 4A62 Peripheral blood 1.61E-01 -9.37E-02 -4.08E-01
Bipolar disorder 6A60-6A6Z Prefrontal cortex 7.97E-01 3.81E-02 2.00E-01
Bladder cancer 2C94 Bladder tissue 1.13E-12 -1.36E+00 -6.23E+00
Breast cancer 2C60-2C6Z Breast tissue 1.89E-140 -1.59E+00 -2.63E+00
Cardioembolic stroke 8B11.20 Whole blood 1.11E-01 -1.56E-01 -6.06E-01
Cervical cancer 2C77 Cervical tissue 1.63E-01 -9.11E-02 -2.16E-01
Childhood onset rheumatic disease FA20.Z Peripheral blood 8.43E-01 -1.10E-01 -1.80E-01
Chronic hepatitis C 1E51.1 Whole blood 7.97E-01 1.45E-01 8.03E-01
Chronic obstructive pulmonary disease CA22 Lung tissue 8.56E-01 -5.19E-02 -1.68E-01
Chronic obstructive pulmonary disease CA22 Small airway epithelium 1.18E-01 -1.21E-01 -3.78E-01
Chronic rhinosinusitis CA0A Sinus mucosa tissue 1.15E-01 -3.05E-01 -7.69E-01
Colon cancer 2B90 Colon tissue 4.87E-135 -1.64E+00 -4.29E+00
Coronary artery disease BA80-BA8Z Peripheral blood 4.38E-01 -1.75E-01 -5.48E-01
Diffuse large B-cell lymphoma 2A81 Tonsil tissue 6.95E-01 -1.37E-01 -4.81E-01
Endometriosis GA10 Endometrium tissue 2.93E-01 -1.40E-02 -2.39E-02
Familial hypercholesterolemia 5C80.00 Peripheral blood 4.36E-03 2.42E-01 1.27E+00
Familial hypercholesterolemia 5C80.00 Whole blood 1.96E-03 -2.25E-01 -8.06E-01
Gastric cancer 2B72 Gastric tissue 3.80E-01 -7.03E-02 -7.55E-02
Glioblastopma 2A00.00 Nervous tissue 5.12E-01 9.16E-02 2.18E-01
Glioma 2A00.0Y-2A00.0Z Brain stem tissue 5.34E-01 2.59E-02 1.39E-01
Glioma 2A00.0Y-2A00.0Z White matter tissue 7.92E-04 -4.04E-01 -1.16E+00
Head and neck cancer 2D42 Head and neck tissue 8.12E-08 3.31E-01 3.91E-01
HIV-associated neurocognitive impairment 8A2Y-8A2Z White matter tissue 1.56E-01 1.16E-01 3.28E-01
Huntington's disease 8A01.10 Whole blood 2.26E-01 -1.12E-01 -5.73E-01
Idiopathic pulmonary fibrosis CB03.4 Lung tissue 7.83E-01 -2.42E-01 -8.65E-01
Immunodeficiency 4A00-4A20 Peripheral blood 7.16E-02 2.14E-01 7.99E-01
Influenza 1E30 Whole blood 2.91E-04 -7.08E-01 -8.14E+00
Interstitial cystitis GC00.3 Bladder tissue 9.07E-01 8.56E-02 5.78E-01
Intracranial aneurysm 8B01.0 Intracranial artery 1.70E-01 -1.70E-01 -4.80E-01
Irritable bowel syndrome DD91.0 Rectal colon tissue 2.17E-02 -6.86E-02 -5.02E-01
Ischemic stroke 8B11 Peripheral blood 3.69E-01 9.63E-05 3.04E-04
Juvenile idiopathic arthritis FA24 Peripheral blood 9.80E-01 1.84E-01 5.37E-01
Lateral sclerosis 8B60.4 Skin 1.84E-01 4.54E-01 1.24E+00
Lateral sclerosis 8B60.4 Cervical spinal cord 9.80E-02 -1.11E-01 -1.37E-01
Liver cancer 2C12.0 Liver tissue 5.87E-04 3.95E-01 8.30E-01
Liver failure DB99.7-DB99.8 Liver tissue 4.39E-05 -7.43E-01 -3.27E+00
Lung cancer 2C25 Lung tissue 3.12E-42 -5.87E-01 -1.66E+00
Lupus erythematosus 4A40 Whole blood 5.54E-01 1.11E-01 2.01E-01
Major depressive disorder 6A70-6A7Z Hippocampus 5.85E-01 2.54E-02 1.34E-01
Major depressive disorder 6A70-6A7Z Whole blood 3.35E-02 -6.59E-02 -1.99E-01
Melanoma 2C30 Skin 9.83E-05 -5.49E-01 -1.04E+00
Multiple myeloma 2A83.1 Peripheral blood 6.08E-01 2.88E-01 4.63E-01
Multiple myeloma 2A83.1 Bone marrow 4.23E-08 1.06E+00 5.89E+00
Multiple sclerosis 8A40 Plasmacytoid dendritic cells 2.26E-01 -9.22E-02 -2.63E-01
Myelodysplastic syndrome 2A36-2A3Z Bone marrow 8.29E-06 2.66E-01 1.14E+00
Myelofibrosis 2A20.2 Whole blood 3.68E-03 -3.11E-01 -2.21E+00
Myocardial infarction BA41-BA50 Peripheral blood 1.41E-01 -4.14E-01 -5.05E-01
Myopathy 8C70.6 Muscle tissue 6.70E-03 3.04E-01 1.36E+00
Neonatal sepsis KA60 Whole blood 3.93E-17 -5.89E-01 -1.45E+00
Neuroectodermal tumour 2A00.11 Brain stem tissue 2.47E-08 -1.11E+00 -3.44E+00
Non-alcoholic fatty liver disease DB92 Liver tissue 9.53E-01 1.54E-01 4.88E-01
Obesity related type 2 diabetes 5A11 Omental adipose tissue 5.74E-01 1.46E-01 5.13E-01
Olive pollen allergy CA08.00 Peripheral blood 3.75E-01 -1.01E-01 -2.31E-01
Oral cancer 2B6E Oral tissue 8.79E-01 -1.69E-01 -2.59E-01
Osteoarthritis FA00-FA0Z Synovial tissue 2.19E-01 4.20E-01 5.88E-01
Osteoporosis FB83.1 Bone marrow 4.61E-01 -6.98E-02 -1.25E-01
Ovarian cancer 2C73 Ovarian tissue 7.40E-01 1.65E-01 2.62E-01
Pancreatic cancer 2C10 Pancreas 8.40E-01 2.72E-03 5.30E-03
Parkinson's disease 8A00.0 Substantia nigra tissue 6.39E-01 -4.01E-02 -1.36E-01
Pediatric respiratory syncytial virus infection CA40.11 Peripheral blood 2.23E-01 -5.21E-02 -3.24E-01
Pituitary cancer 2D12 Pituitary tissue 1.40E-04 8.67E-01 1.65E+00
Pituitary gonadotrope tumour 2D12 Pituitary tissue 2.04E-02 5.68E-01 9.82E-01
Polycystic ovary syndrome 5A80.1 Vastus lateralis muscle 1.54E-01 2.36E-01 9.45E-01
Polycythemia vera 2A20.4 Whole blood 7.77E-11 -2.67E-01 -1.96E+00
Pompe disease 5C51.3 Biceps muscle 2.50E-05 7.88E-01 4.62E+00
Preterm birth KA21.4Z Myometrium 1.74E-01 5.71E-01 7.00E-01
Prostate cancer 2C82 Prostate 2.03E-02 -3.16E-01 -6.16E-01
Psoriasis EA90 Skin 3.20E-20 -5.29E-01 -1.26E+00
Rectal cancer 2B92 Rectal colon tissue 4.32E-23 -1.35E+00 -1.37E+01
Renal cancer 2C90-2C91 Kidney 2.58E-01 1.77E-01 4.76E-01
Retinoblastoma 2D02.2 Uvea 6.58E-02 5.37E-01 2.53E+00
Rheumatoid arthritis FA20 Synovial tissue 5.97E-05 8.90E-01 2.95E+00
Rhinovirus infection CA42.1 Nasal epithelium tissue 9.89E-03 -1.29E-01 -6.21E-01
Schizophrenia 6A20 Prefrontal cortex 1.20E-01 -1.10E-01 -1.17E-01
Schizophrenia 6A20 Superior temporal cortex 1.08E-01 -1.01E-01 -4.45E-01
Scleroderma 4A42.Z Whole blood 2.28E-03 -2.75E-01 -1.44E+00
Seizure 8A60-8A6Z Whole blood 8.45E-01 5.86E-02 1.38E-01
Sensitive skin EK0Z Skin 6.81E-02 -1.18E-01 -7.76E-01
Sepsis with septic shock 1G41 Whole blood 7.24E-28 -4.75E-01 -1.17E+00
Shwachman-Diamond syndrome 3A70.0 Bone marrow 1.53E-02 -2.61E-01 -1.60E+00
Sickle cell disease 3A51.0-3A51.3 Peripheral blood 2.16E-02 -4.22E-01 -1.25E+00
Simpson golabi behmel syndrome LD2C Adipose tissue 5.58E-01 -9.75E-01 -1.17E+00
Sjogren's syndrome 4A43.2 Salivary gland tissue 8.28E-01 1.07E-01 4.81E-01
Skin cancer 2C30-2C3Z Skin 6.49E-70 -9.60E-01 -2.02E+00
Thrombocythemia 3B63 Whole blood 1.82E-04 -2.35E-01 -1.79E+00
Thrombocytopenia 3B64 Whole blood 7.94E-01 4.00E-02 7.88E-02
Thyroid cancer 2D10 Thyroid 1.06E-09 4.25E-01 1.07E+00
Tibial muscular dystrophy 8C75 Muscle tissue 2.24E-04 4.28E-01 1.19E+00
Tuberous sclerosis complex LD2D.2 Perituberal tissue 1.03E-01 5.47E-01 2.27E+00
Type 2 diabetes 5A11 Liver tissue 9.05E-01 -1.49E-01 -2.81E-01
Ureter cancer 2C92 Urothelium 8.35E-01 5.48E-02 1.25E-01
Uterine cancer 2C78 Endometrium tissue 7.77E-50 -1.99E+00 -2.47E+00
Vitiligo ED63.0 Skin 1.03E-01 -2.14E-01 -8.57E-01
------------------------------------------------------------------------------------
⏷ Show the Full List of DME Expression Under 107 Diseases

References

1 Lipid phosphate phosphatase 3 regulates adipocyte sphingolipid synthesis, but not developmental adipogenesis or diet-induced obesity in mice. PLoS One. 2018 Jun 11;13(6):e0198063.