Details of Drug-Metabolizing Enzyme (DME)

General Information of Drug-Metabolizing Enzyme (DME) (ID: DE741FI)

DME Name NADH-ubiquinone oxidoreductase 30 kDa (NDUFS3)
Synonyms NADH-ubiquinone oxidoreductase 30 kDa subunit; Mitochondrial NADH dehydrogenase [ubiquinone] iron-sulfur protein 3; Complex I-30kD; CI-30kD; NDUFS3
Gene Name NDUFS3
UniProt ID
NDUS3_HUMAN
INTEDE ID
DME0120
3D Structure
Download
2D Sequence (FASTA)
Download
3D Structure (PDB)
Download
Gene ID
4722
EC Number EC: 7.1.1.2
Translocase
Hydron translocase
Hydron translocase
EC: 7.1.1.2
Lineage Species: Homo sapiens
Kingdom: Metazoa
Phylum: Chordata
Class: Mammalia
Order: Primates
Family: Hominidae
Genus: Homo
Species: Homo sapiens
Sequence
MAAAAVARLWWRGILGASALTRGTGRPSVLLLPVRRESAGADTRPTVRPRNDVAHKQLSA
FGEYVAEILPKYVQQVQVSCFNELEVCIHPDGVIPVLTFLRDHTNAQFKSLVDLTAVDVP
TRQNRFEIVYNLLSLRFNSRIRVKTYTDELTPIESAVSVFKAANWYEREIWDMFGVFFAN
HPDLRRILTDYGFEGHPFRKDFPLSGYVELRYDDEVKRVVAEPVELAQEFRKFDLNSPWE
AFPVYRQPPESLKLEAGDKKPDAK
Function
This enzyme is the core subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I).Complex I functions in the transfer of electrons from NADH to the respiratory chain. The immediate electron acceptor for the enzyme is believed to be ubiquinone.
KEGG Pathway
Alzheimer's disease (hsa05010 )
Huntington's disease (hsa05016 )
Metabolic pathways (hsa01100 )
Non-alcoholic fatty liver disease (NAFLD) (hsa04932 )
Oxidative phosphorylation (hsa00190 )
Parkinson's disease (hsa05012 )
Retrograde endocannabinoid signaling (hsa04723 )
Thermogenesis (hsa04714 )
Reactome Pathway
Respiratory electron transport (R-HSA-611105 )
Complex I biogenesis (R-HSA-6799198 )

Molecular Interaction Atlas (MIA) of This DME

Molecular Interaction Atlas (MIA) Jump to Detail Molecular Interaction Atlas of This DME
1 Approved Drug(s) Metabolized by This DME
Drug Name Drug ID Indication ICD 11 Highest Status REF
Doxorubicin DMVP5YE Acute myelogenous leukaemia 2A41 Approved [1]

Molecular Expression Atlas (MEA) of This DME

Molecular Expression Atlas (MEA) Jump to Detail Molecular Expression Atlas of This DME
Disease Name ICD 11 Studied Tissue p-value Fold-Change Z-score
Acute myelocytic leukaemia 2B33.1 Bone marrow 1.68E-18 2.66E-01 9.68E-01
Alopecia ED70 Skin from scalp 3.41E-01 1.06E-01 3.42E-01
Alzheimer's disease 8A20 Entorhinal cortex 3.62E-06 -2.65E-01 -9.39E-01
Ankylosing spondylitis FA92.0 Pheripheral blood 2.03E-01 1.34E-01 4.72E-01
Aortic stenosis BB70 Calcified aortic valve 9.37E-01 3.91E-02 3.98E-02
Apnea 7A40 Hyperplastic tonsil 8.54E-01 2.43E-01 4.08E-01
Arthropathy FA00-FA5Z Peripheral blood 1.43E-01 -1.30E-01 -5.94E-01
Asthma CA23 Nasal and bronchial airway 3.92E-08 3.64E-01 8.20E-01
Atopic dermatitis EA80 Skin 6.88E-03 9.11E-02 5.50E-01
Autism 6A02 Whole blood 5.10E-01 -9.88E-02 -1.91E-01
Autoimmune uveitis 9A96 Peripheral monocyte 4.25E-01 -1.57E-01 -5.45E-01
Autosomal dominant monocytopenia 4B04 Whole blood 1.00E-02 4.03E-01 1.02E+00
Bacterial infection of gingival 1C1H Gingival tissue 3.62E-01 5.87E-03 2.36E-02
Batten disease 5C56.1 Whole blood 5.96E-01 -1.93E-01 -2.05E+00
Behcet's disease 4A62 Peripheral blood 9.63E-01 -2.78E-02 -1.05E-01
Bipolar disorder 6A60-6A6Z Prefrontal cortex 3.11E-01 4.21E-02 2.19E-01
Bladder cancer 2C94 Bladder tissue 4.88E-01 -1.14E-02 -1.07E-01
Breast cancer 2C60-2C6Z Breast tissue 2.48E-18 2.89E-01 8.64E-01
Cardioembolic stroke 8B11.20 Whole blood 1.76E-01 -7.85E-02 -4.13E-01
Cervical cancer 2C77 Cervical tissue 4.56E-03 -2.75E-01 -7.79E-01
Childhood onset rheumatic disease FA20.Z Peripheral blood 8.79E-01 -6.08E-02 -8.15E-02
Chronic hepatitis C 1E51.1 Whole blood 8.33E-01 -3.00E-02 -2.45E-01
Chronic obstructive pulmonary disease CA22 Lung tissue 3.66E-01 -2.87E-02 -1.11E-01
Chronic obstructive pulmonary disease CA22 Small airway epithelium 5.80E-01 -3.28E-02 -1.13E-01
Chronic rhinosinusitis CA0A Sinus mucosa tissue 2.90E-01 -3.05E-01 -8.61E-01
Colon cancer 2B90 Colon tissue 8.02E-61 -5.04E-01 -1.93E+00
Coronary artery disease BA80-BA8Z Peripheral blood 9.77E-01 -5.94E-02 -1.40E-01
Diffuse large B-cell lymphoma 2A81 Tonsil tissue 7.20E-01 -1.68E-03 -2.44E-03
Endometriosis GA10 Endometrium tissue 1.85E-01 -1.05E-01 -3.01E-01
Familial hypercholesterolemia 5C80.00 Peripheral blood 8.34E-01 2.44E-02 1.45E-01
Familial hypercholesterolemia 5C80.00 Whole blood 1.00E-11 1.41E+00 2.09E+00
Gastric cancer 2B72 Gastric tissue 5.81E-01 3.43E-01 8.35E-01
Glioblastopma 2A00.00 Nervous tissue 2.79E-24 -3.21E-01 -8.09E-01
Glioma 2A00.0Y-2A00.0Z Brain stem tissue 2.12E-01 -3.04E-01 -1.37E+00
Glioma 2A00.0Y-2A00.0Z White matter tissue 7.93E-07 1.33E+00 3.05E+00
Head and neck cancer 2D42 Head and neck tissue 2.42E-18 -3.41E-01 -1.48E+00
HIV-associated neurocognitive impairment 8A2Y-8A2Z White matter tissue 2.93E-01 -2.94E-01 -6.41E-01
Huntington's disease 8A01.10 Whole blood 4.97E-01 -1.18E-01 -5.02E-01
Idiopathic pulmonary fibrosis CB03.4 Lung tissue 1.52E-01 1.73E-01 5.56E-01
Immunodeficiency 4A00-4A20 Peripheral blood 9.03E-01 -8.88E-02 -4.46E-01
Influenza 1E30 Whole blood 8.30E-06 -1.02E+00 -1.14E+01
Interstitial cystitis GC00.3 Bladder tissue 6.39E-02 -1.02E-01 -1.11E+00
Intracranial aneurysm 8B01.0 Intracranial artery 1.14E-01 6.28E-02 2.60E-01
Irritable bowel syndrome DD91.0 Rectal colon tissue 2.11E-02 -4.78E-01 -1.01E+00
Ischemic stroke 8B11 Peripheral blood 9.35E-03 -2.10E-01 -1.21E+00
Juvenile idiopathic arthritis FA24 Peripheral blood 3.01E-13 -3.30E-01 -1.01E+00
Lateral sclerosis 8B60.4 Skin 1.03E-01 2.30E-01 1.24E+00
Lateral sclerosis 8B60.4 Cervical spinal cord 2.03E-01 -9.21E-02 -1.07E-01
Liver cancer 2C12.0 Liver tissue 1.62E-01 -1.24E-01 -2.78E-01
Liver failure DB99.7-DB99.8 Liver tissue 7.90E-01 -4.92E-02 -1.68E-01
Lung cancer 2C25 Lung tissue 3.05E-16 2.65E-01 9.72E-01
Lupus erythematosus 4A40 Whole blood 5.36E-03 7.70E-01 8.07E-01
Major depressive disorder 6A70-6A7Z Hippocampus 8.00E-01 3.53E-02 2.38E-01
Major depressive disorder 6A70-6A7Z Whole blood 2.68E-01 -2.03E-01 -3.72E-01
Melanoma 2C30 Skin 1.15E-01 -1.48E-01 -2.79E-01
Multiple myeloma 2A83.1 Peripheral blood 3.52E-01 -2.29E-01 -6.05E-01
Multiple myeloma 2A83.1 Bone marrow 1.38E-05 6.46E-01 3.21E+00
Multiple sclerosis 8A40 Plasmacytoid dendritic cells 3.61E-02 1.14E-01 6.89E-01
Myelodysplastic syndrome 2A36-2A3Z Bone marrow 2.99E-03 -1.59E-01 -4.54E-01
Myelofibrosis 2A20.2 Whole blood 4.27E-01 3.99E-02 1.57E-01
Myocardial infarction BA41-BA50 Peripheral blood 1.86E-01 -4.63E-01 -6.05E-01
Myopathy 8C70.6 Muscle tissue 8.35E-03 -1.52E-01 -8.31E-01
Neonatal sepsis KA60 Whole blood 3.89E-01 1.10E-03 2.61E-03
Neuroectodermal tumour 2A00.11 Brain stem tissue 3.44E-05 5.86E-01 2.46E+00
Non-alcoholic fatty liver disease DB92 Liver tissue 8.10E-01 6.89E-02 2.91E-01
Obesity related type 2 diabetes 5A11 Omental adipose tissue 3.12E-01 -9.69E-02 -5.32E-01
Olive pollen allergy CA08.00 Peripheral blood 5.35E-01 1.18E-01 1.73E-01
Oral cancer 2B6E Oral tissue 4.07E-05 -4.37E-01 -7.87E-01
Osteoarthritis FA00-FA0Z Synovial tissue 8.94E-01 -8.69E-02 -7.98E-02
Osteoporosis FB83.1 Bone marrow 6.18E-03 -4.58E-01 -1.67E+00
Ovarian cancer 2C73 Ovarian tissue 6.49E-05 8.12E-01 2.84E+00
Pancreatic cancer 2C10 Pancreas 3.37E-03 1.15E-01 5.76E-01
Parkinson's disease 8A00.0 Substantia nigra tissue 4.40E-01 6.04E-03 1.48E-02
Pediatric respiratory syncytial virus infection CA40.11 Peripheral blood 6.25E-01 -1.86E-03 -1.43E-02
Pituitary cancer 2D12 Pituitary tissue 5.07E-07 7.51E-01 3.45E+00
Pituitary gonadotrope tumour 2D12 Pituitary tissue 6.81E-07 8.09E-01 3.27E+00
Polycystic ovary syndrome 5A80.1 Vastus lateralis muscle 8.96E-01 6.86E-02 2.89E-01
Polycythemia vera 2A20.4 Whole blood 4.00E-05 -2.37E-01 -9.22E-01
Pompe disease 5C51.3 Biceps muscle 2.44E-02 -1.38E-01 -1.45E+00
Preterm birth KA21.4Z Myometrium 4.38E-01 -4.83E-02 -2.18E-01
Prostate cancer 2C82 Prostate 2.82E-03 5.63E-01 1.22E+00
Psoriasis EA90 Skin 2.06E-16 2.36E-01 1.13E+00
Rectal cancer 2B92 Rectal colon tissue 1.90E-04 -5.99E-01 -3.12E+00
Renal cancer 2C90-2C91 Kidney 4.46E-06 -4.48E-01 -2.47E+00
Retinoblastoma 2D02.2 Uvea 9.29E-08 5.25E-01 3.21E+00
Rheumatoid arthritis FA20 Synovial tissue 1.21E-01 1.13E+00 1.03E+00
Rhinovirus infection CA42.1 Nasal epithelium tissue 4.35E-02 -2.01E-02 -1.83E-01
Schizophrenia 6A20 Prefrontal cortex 1.74E-04 -2.73E-01 -7.33E-01
Schizophrenia 6A20 Superior temporal cortex 9.02E-02 -1.39E-01 -6.32E-01
Scleroderma 4A42.Z Whole blood 9.96E-01 7.01E-02 4.28E-01
Seizure 8A60-8A6Z Whole blood 2.61E-01 6.64E-01 1.46E+00
Sensitive skin EK0Z Skin 9.05E-01 6.84E-03 5.27E-02
Sepsis with septic shock 1G41 Whole blood 8.02E-01 -1.63E-02 -3.29E-02
Shwachman-Diamond syndrome 3A70.0 Bone marrow 2.33E-04 -5.08E-01 -2.50E+00
Sickle cell disease 3A51.0-3A51.3 Peripheral blood 1.08E-01 -1.60E-02 -5.02E-02
Simpson golabi behmel syndrome LD2C Adipose tissue 8.10E-01 -9.53E-02 -3.80E-01
Sjogren's syndrome 4A43.2 Salivary gland tissue 1.83E-01 -1.05E-01 -3.23E-01
Skin cancer 2C30-2C3Z Skin 3.20E-04 1.25E-01 4.01E-01
Thrombocythemia 3B63 Whole blood 5.63E-02 -9.43E-02 -3.62E-01
Thrombocytopenia 3B64 Whole blood 4.57E-01 2.32E-01 2.39E-01
Thyroid cancer 2D10 Thyroid 9.99E-13 -2.34E-01 -1.06E+00
Tibial muscular dystrophy 8C75 Muscle tissue 1.97E-02 -4.08E-01 -1.22E+00
Tuberous sclerosis complex LD2D.2 Perituberal tissue 1.49E-02 -3.31E-01 -3.33E+00
Type 2 diabetes 5A11 Liver tissue 7.58E-01 -6.42E-02 -4.69E-01
Ureter cancer 2C92 Urothelium 8.28E-01 3.24E-02 1.48E-01
Uterine cancer 2C78 Endometrium tissue 1.41E-11 -2.50E-01 -6.57E-01
Vitiligo ED63.0 Skin 5.19E-02 8.01E-02 8.87E-01
------------------------------------------------------------------------------------
⏷ Show the Full List of DME Expression Under 107 Diseases

References

1 Differential ability of cytostatics from anthraquinone group to generate free radicals in three enzymatic systems: NADH dehydrogenase, NADPH cytochrome P450 reductase, and xanthine oxidase. Oncol Res. 2003;13(5):245-52.