Details of Drug-Metabolizing Enzyme (DME)

General Information of Drug-Metabolizing Enzyme (DME) (ID: DE870HF)

DME Name Aminomuconic semialdehyde dehydrogenase (ALDH12)
Synonyms Aldehyde dehydrogenase family 8 member A1; Aldehyde dehydrogenase 12; 2-aminomuconic semialdehyde dehydrogenase; ALDH12; ALDH8A1
Gene Name ALDH8A1
UniProt ID
AL8A1_HUMAN
INTEDE ID
DME0299
3D Structure
Download
2D Sequence (FASTA)
Download
3D Structure (PDB)
Download
Gene ID
64577
EC Number EC: 1.2.1.3
Oxidoreductase
Aldehyde/oxo donor oxidoreductase
NAD/NADP acceptor oxidoreductase
EC: 1.2.1.3
Lineage Species: Homo sapiens
Kingdom: Metazoa
Phylum: Chordata
Class: Mammalia
Order: Primates
Family: Hominidae
Genus: Homo
Species: Homo sapiens
Sequence
MAGTNALLMLENFIDGKFLPCSSYIDSYDPSTGEVYCRVPNSGKDEIEAAVKAAREAFPS
WSSRSPQERSRVLNQVADLLEQSLEEFAQAESKDQGKTLALARTMDIPRSVQNFRFFASS
SLHHTSECTQMDHLGCMHYTVRAPVGVAGLISPWNLPLYLLTWKIAPAMAAGNTVIAKPS
ELTSVTAWMLCKLLDKAGVPPGVVNIVFGTGPRVGEALVSHPEVPLISFTGSQPTAERIT
QLSAPHCKKLSLELGGKNPAIIFEDANLDECIPATVRSSFANQGEICLCTSRIFVQKSIY
SEFLKRFVEATRKWKVGIPSDPLVSIGALISKAHLEKVRSYVKRALAEGAQIWCGEGVDK
LSLPARNQAGYFMLPTVITDIKDESCCMTEEIFGPVTCVVPFDSEEEVIERANNVKYGLA
ATVWSSNVGRVHRVAKKLQSGLVWTNCWLIRELNLPFGGMKSSGIGREGAKDSYDFFTEI
KTITVKH
Function This enzyme catalyzes the NAD-dependent oxidation of 2-aminomuconic semialdehyde of the kynurenine metabolic pathway in L-tryptophan degradation.
KEGG Pathway
Metabolic pathways (hsa01100 )
Tryptophan metabolism (hsa00380 )
Reactome Pathway
RA biosynthesis pathway (R-HSA-5365859 )

Molecular Interaction Atlas (MIA) of This DME

Molecular Interaction Atlas (MIA) Jump to Detail Molecular Interaction Atlas of This DME
1 Investigative Drug(s) Metabolized by This DME
Drug Name Drug ID Indication ICD 11 Highest Status REF
3,4-dihydroxyphenylacetaldehyde DM7N3MX Discovery agent N.A. Investigative [1]
Experimental Enzyme Kinetic Data of Drugs
Drug Name Indication Highest Status Kinetic Data REF
3,4-dihydroxyphenylacetaldehyde Discovery agent [N.A.] Investigative Km = 0.0004 microM [1]

Molecular Expression Atlas (MEA) of This DME

Molecular Expression Atlas (MEA) Jump to Detail Molecular Expression Atlas of This DME
Disease Name ICD 11 Studied Tissue p-value Fold-Change Z-score
Acute myelocytic leukaemia 2B33.1 Bone marrow 2.00E-02 9.47E-03 3.85E-02
Alopecia ED70 Skin from scalp 1.81E-01 -2.69E-01 -3.59E-01
Alzheimer's disease 8A20 Entorhinal cortex 1.73E-01 2.86E-02 4.44E-02
Ankylosing spondylitis FA92.0 Pheripheral blood 2.96E-01 2.96E-01 7.23E-01
Aortic stenosis BB70 Calcified aortic valve 3.04E-01 9.41E-01 9.51E-01
Apnea 7A40 Hyperplastic tonsil 5.30E-01 5.49E-02 2.85E-01
Arthropathy FA00-FA5Z Peripheral blood 9.02E-01 -2.14E-01 -3.66E-01
Asthma CA23 Nasal and bronchial airway 8.48E-01 -1.54E-02 -2.83E-02
Atopic dermatitis EA80 Skin 6.43E-04 8.83E-01 1.44E+00
Autism 6A02 Whole blood 6.55E-01 -2.02E-01 -3.18E-01
Autoimmune uveitis 9A96 Peripheral monocyte 2.37E-01 9.76E-02 2.63E-01
Autosomal dominant monocytopenia 4B04 Whole blood 1.90E-01 3.14E-01 8.15E-01
Bacterial infection of gingival 1C1H Gingival tissue 7.99E-01 4.71E-03 1.24E-02
Batten disease 5C56.1 Whole blood 6.65E-01 1.18E-01 1.61E-01
Behcet's disease 4A62 Peripheral blood 6.48E-01 6.59E-02 1.58E-01
Bipolar disorder 6A60-6A6Z Prefrontal cortex 9.64E-01 1.55E-01 3.20E-01
Bladder cancer 2C94 Bladder tissue 6.36E-01 -1.35E-01 -2.13E-01
Breast cancer 2C60-2C6Z Breast tissue 3.87E-20 4.52E-01 5.92E-01
Cardioembolic stroke 8B11.20 Whole blood 8.68E-01 3.04E-02 3.90E-02
Cervical cancer 2C77 Cervical tissue 5.59E-01 -7.25E-02 -9.03E-02
Childhood onset rheumatic disease FA20.Z Peripheral blood 7.36E-01 9.64E-02 2.42E-01
Chronic hepatitis C 1E51.1 Whole blood 9.00E-03 -4.40E-01 -1.55E+00
Chronic obstructive pulmonary disease CA22 Lung tissue 8.84E-01 2.71E-02 6.43E-02
Chronic obstructive pulmonary disease CA22 Small airway epithelium 8.62E-01 1.20E-03 6.03E-03
Chronic rhinosinusitis CA0A Sinus mucosa tissue 4.15E-01 9.69E-02 5.18E-01
Colon cancer 2B90 Colon tissue 2.49E-20 1.13E-01 4.34E-01
Coronary artery disease BA80-BA8Z Peripheral blood 4.77E-01 -4.01E-01 -2.87E-01
Diffuse large B-cell lymphoma 2A81 Tonsil tissue 8.76E-01 -3.67E-01 -2.90E-01
Endometriosis GA10 Endometrium tissue 2.53E-01 4.45E-02 1.01E-01
Familial hypercholesterolemia 5C80.00 Peripheral blood 6.20E-01 -2.05E-01 -6.74E-01
Familial hypercholesterolemia 5C80.00 Whole blood 2.10E-01 -4.68E-02 -1.70E-01
Gastric cancer 2B72 Gastric tissue 3.76E-01 -7.27E-01 -6.43E-01
Glioblastopma 2A00.00 Nervous tissue 5.35E-65 -1.27E+00 -1.38E+00
Glioma 2A00.0Y-2A00.0Z Brain stem tissue 2.87E-02 -2.52E+00 -6.05E+00
Glioma 2A00.0Y-2A00.0Z White matter tissue 6.20E-01 -3.05E-01 -2.30E-01
Head and neck cancer 2D42 Head and neck tissue 2.50E-06 1.25E-01 6.27E-01
HIV-associated neurocognitive impairment 8A2Y-8A2Z White matter tissue 9.93E-01 1.54E-01 1.43E-01
Huntington's disease 8A01.10 Whole blood 9.31E-01 3.83E-02 3.05E-01
Idiopathic pulmonary fibrosis CB03.4 Lung tissue 1.44E-01 -6.05E-01 -9.51E-01
Immunodeficiency 4A00-4A20 Peripheral blood 6.83E-01 1.75E-01 3.48E-01
Influenza 1E30 Whole blood 9.38E-04 1.18E+00 9.91E+00
Interstitial cystitis GC00.3 Bladder tissue 2.13E-02 6.29E-01 1.81E+00
Intracranial aneurysm 8B01.0 Intracranial artery 9.44E-02 -5.99E-01 -6.56E-01
Irritable bowel syndrome DD91.0 Rectal colon tissue 1.10E-02 2.63E-01 5.19E-01
Ischemic stroke 8B11 Peripheral blood 3.59E-01 -2.10E-01 -6.07E-01
Juvenile idiopathic arthritis FA24 Peripheral blood 3.90E-03 -3.80E-01 -6.19E-01
Lateral sclerosis 8B60.4 Skin 4.38E-01 4.30E-02 3.86E-01
Lateral sclerosis 8B60.4 Cervical spinal cord 2.74E-01 5.81E-01 7.17E-01
Liver cancer 2C12.0 Liver tissue 3.27E-65 -1.76E+00 -5.08E+00
Liver failure DB99.7-DB99.8 Liver tissue 1.10E-03 -4.48E+00 -1.89E+01
Lung cancer 2C25 Lung tissue 8.68E-08 7.51E-02 1.76E-01
Lupus erythematosus 4A40 Whole blood 3.57E-01 -1.55E-01 -2.98E-01
Major depressive disorder 6A70-6A7Z Hippocampus 8.70E-01 -5.35E-03 -1.15E-02
Major depressive disorder 6A70-6A7Z Whole blood 9.93E-01 -5.60E-02 -8.82E-02
Melanoma 2C30 Skin 4.30E-01 2.11E-02 2.02E-02
Multiple myeloma 2A83.1 Peripheral blood 8.99E-02 2.86E-01 5.73E-01
Multiple myeloma 2A83.1 Bone marrow 8.32E-06 3.66E-01 2.02E+00
Multiple sclerosis 8A40 Plasmacytoid dendritic cells 6.49E-01 5.00E-02 5.93E-02
Myelodysplastic syndrome 2A36-2A3Z Bone marrow 1.83E-01 -2.23E-01 -2.80E-01
Myelofibrosis 2A20.2 Whole blood 9.34E-01 -1.06E-01 -3.83E-01
Myocardial infarction BA41-BA50 Peripheral blood 1.29E-01 -2.44E-01 -2.23E-01
Myopathy 8C70.6 Muscle tissue 9.38E-03 -4.01E-01 -1.63E+00
Neonatal sepsis KA60 Whole blood 2.21E-06 -1.65E-01 -3.10E-01
Neuroectodermal tumour 2A00.11 Brain stem tissue 6.39E-01 -5.35E-01 -5.70E-01
Non-alcoholic fatty liver disease DB92 Liver tissue 7.58E-01 -5.54E-02 -2.49E-01
Obesity related type 2 diabetes 5A11 Omental adipose tissue 2.76E-01 -6.48E-01 -6.07E-01
Olive pollen allergy CA08.00 Peripheral blood 9.07E-02 -6.63E-01 -7.59E-01
Oral cancer 2B6E Oral tissue 7.85E-04 2.02E-01 6.86E-01
Osteoarthritis FA00-FA0Z Synovial tissue 8.49E-01 -2.25E-01 -3.21E-01
Osteoporosis FB83.1 Bone marrow 6.56E-01 -3.78E-02 -2.52E-01
Ovarian cancer 2C73 Ovarian tissue 1.07E-03 6.51E-02 2.38E-01
Pancreatic cancer 2C10 Pancreas 5.61E-01 -3.24E-01 -5.31E-01
Parkinson's disease 8A00.0 Substantia nigra tissue 7.82E-01 -4.47E-01 -4.76E-01
Pediatric respiratory syncytial virus infection CA40.11 Peripheral blood 3.09E-01 -8.35E-02 -2.26E-01
Pituitary cancer 2D12 Pituitary tissue 6.86E-01 -1.75E-01 -6.21E-01
Pituitary gonadotrope tumour 2D12 Pituitary tissue 2.39E-01 -2.53E-01 -8.82E-01
Polycystic ovary syndrome 5A80.1 Vastus lateralis muscle 1.62E-01 -2.21E-01 -7.80E-01
Polycythemia vera 2A20.4 Whole blood 7.31E-01 1.50E-01 5.39E-01
Pompe disease 5C51.3 Biceps muscle 4.40E-01 7.51E-02 3.48E-01
Preterm birth KA21.4Z Myometrium 9.58E-02 1.25E+00 1.69E+00
Prostate cancer 2C82 Prostate 9.66E-01 1.82E-02 3.57E-02
Psoriasis EA90 Skin 4.92E-03 1.07E-01 2.21E-01
Rectal cancer 2B92 Rectal colon tissue 1.21E-01 8.81E-02 3.91E-01
Renal cancer 2C90-2C91 Kidney 7.44E-04 -2.28E+00 -1.54E+00
Retinoblastoma 2D02.2 Uvea 3.56E-01 -5.69E-01 -7.46E-01
Rheumatoid arthritis FA20 Synovial tissue 1.08E-01 -4.22E-01 -6.73E-01
Rhinovirus infection CA42.1 Nasal epithelium tissue 6.03E-01 -2.18E-02 -1.79E-01
Schizophrenia 6A20 Prefrontal cortex 1.46E-01 -3.15E-01 -3.30E-01
Schizophrenia 6A20 Superior temporal cortex 3.86E-01 -7.09E-02 -2.40E-01
Scleroderma 4A42.Z Whole blood 5.25E-02 -7.34E-01 -1.13E+00
Seizure 8A60-8A6Z Whole blood 7.15E-01 1.28E-01 1.96E-01
Sensitive skin EK0Z Skin 3.81E-01 -2.55E-01 -4.39E-01
Sepsis with septic shock 1G41 Whole blood 3.94E-05 -1.57E-01 -2.82E-01
Shwachman-Diamond syndrome 3A70.0 Bone marrow 7.86E-01 9.02E-02 2.85E-01
Sickle cell disease 3A51.0-3A51.3 Peripheral blood 2.57E-02 -1.79E-01 -1.07E+00
Simpson golabi behmel syndrome LD2C Adipose tissue 4.83E-01 -5.50E-02 -1.85E-01
Sjogren's syndrome 4A43.2 Salivary gland tissue 5.93E-05 5.59E-01 6.66E+00
Skin cancer 2C30-2C3Z Skin 1.35E-04 6.72E-02 1.09E-01
Thrombocythemia 3B63 Whole blood 9.21E-01 -2.80E-02 -1.02E-01
Thrombocytopenia 3B64 Whole blood 3.39E-01 3.32E-01 8.31E-01
Thyroid cancer 2D10 Thyroid 3.65E-01 2.75E-02 5.92E-02
Tibial muscular dystrophy 8C75 Muscle tissue 4.73E-02 -3.93E-01 -7.36E-01
Tuberous sclerosis complex LD2D.2 Perituberal tissue 3.27E-01 2.82E-01 9.29E-01
Type 2 diabetes 5A11 Liver tissue 2.74E-01 7.55E-02 1.41E-01
Ureter cancer 2C92 Urothelium 8.51E-01 2.35E-02 1.43E-01
Uterine cancer 2C78 Endometrium tissue 3.15E-04 1.66E-01 1.78E-01
Vitiligo ED63.0 Skin 1.83E-02 6.75E-01 1.22E+00
------------------------------------------------------------------------------------
⏷ Show the Full List of DME Expression Under 107 Diseases

References

1 Neurotoxicity and metabolism of the catecholamine-derived 3,4-dihydroxyphenylacetaldehyde and 3,4-dihydroxyphenylglycolaldehyde: the role of aldehyde dehydrogenase. Pharmacol Rev. 2007 Jun;59(2):125-50.