Details of Drug-Metabolizing Enzyme (DME)

General Information of Drug-Metabolizing Enzyme (DME) (ID: DE8K7F3)

DME Name GDP-mannose 4,6-dehydratase (GMDS)
Synonyms GDP-D-mannose dehydratase; GDP-alpha-D-mannose 4,6-dehydratase; GDP-D-mannose 4,6-dehydratase; GDP-D-mannose 4-oxido-6-reductase; GDP-D-mannose dehydratase; GDP-D-mannose-4,6-dehydratase; GMD; GMDS
Gene Name GMDS
UniProt ID
GMDS_HUMAN
INTEDE ID
DME0529
3D Structure
Download
2D Sequence (FASTA)
Download
3D Structure (PDB)
Download
Gene ID
2762
EC Number EC: 4.2.1.47
Lyases
Carbon-oxygen lyase
Hydro-lyase
EC: 4.2.1.47
Lineage Species: Homo sapiens
Kingdom: Metazoa
Phylum: Chordata
Class: Mammalia
Order: Primates
Family: Hominidae
Genus: Homo
Species: Homo sapiens
Sequence
MAHAPARCPSARGSGDGEMGKPRNVALITGITGQDGSYLAEFLLEKGYEVHGIVRRSSSF
NTGRIEHLYKNPQAHIEGNMKLHYGDLTDSTCLVKIINEVKPTEIYNLGAQSHVKISFDL
AEYTADVDGVGTLRLLDAVKTCGLINSVKFYQASTSELYGKVQEIPQKETTPFYPRSPYG
AAKLYAYWIVVNFREAYNLFAVNGILFNHESPRRGANFVTRKISRSVAKIYLGQLECFSL
GNLDAKRDWGHAKDYVEAMWLMLQNDEPEDFVIATGEVHSVREFVEKSFLHIGKTIVWEG
KNENEVGRCKETGKVHVTVDLKYYRPTEVDFLQGDCTKAKQKLNWKPRVAFDELVREMVH
ADVELMRTNPNA
Function This enzyme catalyzes the conversion of GDP-D-mannose to GDP-4-dehydro-6- deoxy-D-mannose.
KEGG Pathway
Amino sugar and nucleotide sugar metabolism (hsa00520 )
Fructose and mannose metabolism (hsa00051 )
Metabolic pathways (hsa01100 )
Reactome Pathway
GDP-fucose biosynthesis (R-HSA-6787639 )

Molecular Interaction Atlas (MIA) of This DME

Molecular Interaction Atlas (MIA) Jump to Detail Molecular Interaction Atlas of This DME
1 Investigative Drug(s) Metabolized by This DME
Drug Name Drug ID Indication ICD 11 Highest Status REF
GDP-mannose DMOC25M N. A. N. A. Investigative [1]

Molecular Expression Atlas (MEA) of This DME

Molecular Expression Atlas (MEA) Jump to Detail Molecular Expression Atlas of This DME
Disease Name ICD 11 Studied Tissue p-value Fold-Change Z-score
Acute myelocytic leukaemia 2B33.1 Bone marrow 1.27E-55 9.26E-01 2.29E+00
Alopecia ED70 Skin from scalp 1.07E-01 -8.12E-02 -1.53E-01
Alzheimer's disease 8A20 Entorhinal cortex 6.04E-07 -3.75E-01 -6.83E-01
Ankylosing spondylitis FA92.0 Pheripheral blood 2.02E-01 3.33E-01 8.14E-01
Aortic stenosis BB70 Calcified aortic valve 6.88E-01 6.06E-02 4.68E-02
Apnea 7A40 Hyperplastic tonsil 6.07E-02 2.47E+00 7.41E+00
Arthropathy FA00-FA5Z Peripheral blood 9.96E-01 -3.97E-02 -2.05E-01
Asthma CA23 Nasal and bronchial airway 2.15E-02 3.73E-01 3.80E-01
Atopic dermatitis EA80 Skin 4.05E-02 1.21E-01 2.86E-01
Autism 6A02 Whole blood 2.78E-02 -1.82E-01 -3.95E-01
Autoimmune uveitis 9A96 Peripheral monocyte 6.17E-01 -1.39E-01 -2.79E-01
Autosomal dominant monocytopenia 4B04 Whole blood 3.32E-01 -3.09E-01 -6.08E-01
Bacterial infection of gingival 1C1H Gingival tissue 2.14E-07 4.23E-01 7.76E-01
Batten disease 5C56.1 Whole blood 2.05E-01 -1.10E-01 -5.89E-01
Behcet's disease 4A62 Peripheral blood 3.29E-01 -5.15E-03 -2.98E-02
Bipolar disorder 6A60-6A6Z Prefrontal cortex 7.42E-01 -2.04E-02 -5.81E-02
Bladder cancer 2C94 Bladder tissue 4.17E-01 -2.67E-01 -8.66E-01
Breast cancer 2C60-2C6Z Breast tissue 6.87E-32 5.90E-01 8.73E-01
Cardioembolic stroke 8B11.20 Whole blood 1.15E-03 -2.69E-01 -1.53E+00
Cervical cancer 2C77 Cervical tissue 3.65E-02 -3.65E-01 -3.76E-01
Childhood onset rheumatic disease FA20.Z Peripheral blood 5.59E-01 1.11E-01 1.70E-01
Chronic hepatitis C 1E51.1 Whole blood 5.66E-02 8.11E-03 5.10E-02
Chronic obstructive pulmonary disease CA22 Lung tissue 6.75E-02 -3.96E-01 -6.97E-01
Chronic obstructive pulmonary disease CA22 Small airway epithelium 6.38E-04 2.60E-01 4.32E-01
Chronic rhinosinusitis CA0A Sinus mucosa tissue 7.80E-02 5.29E-01 1.01E+00
Colon cancer 2B90 Colon tissue 8.47E-09 2.70E-01 6.93E-01
Coronary artery disease BA80-BA8Z Peripheral blood 5.76E-01 6.48E-02 2.86E-01
Diffuse large B-cell lymphoma 2A81 Tonsil tissue 7.15E-01 1.53E-01 2.87E-01
Endometriosis GA10 Endometrium tissue 1.01E-01 -1.93E-01 -4.03E-01
Familial hypercholesterolemia 5C80.00 Peripheral blood 8.55E-02 1.11E-01 6.69E-01
Familial hypercholesterolemia 5C80.00 Whole blood 8.89E-10 9.46E-01 1.53E+00
Gastric cancer 2B72 Gastric tissue 6.70E-01 4.20E-01 3.36E-01
Glioblastopma 2A00.00 Nervous tissue 2.18E-01 -9.53E-02 -1.50E-01
Glioma 2A00.0Y-2A00.0Z Brain stem tissue 9.08E-01 1.01E-02 2.42E-02
Glioma 2A00.0Y-2A00.0Z White matter tissue 3.14E-02 6.06E-01 1.50E+00
Head and neck cancer 2D42 Head and neck tissue 1.07E-30 -9.91E-01 -1.87E+00
HIV-associated neurocognitive impairment 8A2Y-8A2Z White matter tissue 6.40E-01 -1.19E-01 -2.39E-01
Huntington's disease 8A01.10 Whole blood 8.91E-01 -1.20E-01 -2.77E-01
Idiopathic pulmonary fibrosis CB03.4 Lung tissue 2.15E-02 6.81E-01 1.59E+00
Immunodeficiency 4A00-4A20 Peripheral blood 4.76E-04 5.37E-01 1.81E+00
Influenza 1E30 Whole blood 3.85E-02 1.65E-01 1.64E+00
Interstitial cystitis GC00.3 Bladder tissue 4.44E-01 5.42E-02 4.71E-01
Intracranial aneurysm 8B01.0 Intracranial artery 3.13E-05 7.64E-01 2.30E+00
Irritable bowel syndrome DD91.0 Rectal colon tissue 6.37E-01 -1.54E-01 -2.09E-01
Ischemic stroke 8B11 Peripheral blood 7.36E-01 1.01E-01 4.49E-01
Juvenile idiopathic arthritis FA24 Peripheral blood 4.24E-04 -4.21E-01 -7.34E-01
Lateral sclerosis 8B60.4 Skin 2.07E-01 1.32E-01 5.30E-01
Lateral sclerosis 8B60.4 Cervical spinal cord 1.70E-01 -2.10E-01 -2.22E-01
Liver cancer 2C12.0 Liver tissue 7.65E-01 -4.42E-02 -6.84E-02
Liver failure DB99.7-DB99.8 Liver tissue 8.05E-02 -5.01E-01 -8.78E-01
Lung cancer 2C25 Lung tissue 4.78E-66 8.78E-01 1.86E+00
Lupus erythematosus 4A40 Whole blood 2.44E-02 3.16E-01 3.63E-01
Major depressive disorder 6A70-6A7Z Hippocampus 6.91E-01 1.54E-01 6.55E-01
Major depressive disorder 6A70-6A7Z Whole blood 9.52E-01 1.47E-02 2.27E-02
Melanoma 2C30 Skin 5.06E-01 -2.23E-01 -2.68E-01
Multiple myeloma 2A83.1 Peripheral blood 3.73E-01 -2.18E-01 -4.68E-01
Multiple myeloma 2A83.1 Bone marrow 1.50E-03 7.92E-01 1.46E+00
Multiple sclerosis 8A40 Plasmacytoid dendritic cells 1.23E-01 4.19E-01 1.38E+00
Myelodysplastic syndrome 2A36-2A3Z Bone marrow 4.52E-01 1.64E-01 3.04E-01
Myelofibrosis 2A20.2 Whole blood 3.28E-03 -4.09E-01 -1.54E+00
Myocardial infarction BA41-BA50 Peripheral blood 4.77E-01 1.36E-01 2.18E-01
Myopathy 8C70.6 Muscle tissue 4.60E-03 6.39E-01 1.78E+00
Neonatal sepsis KA60 Whole blood 2.05E-01 2.50E-01 5.94E-01
Neuroectodermal tumour 2A00.11 Brain stem tissue 1.50E-03 1.07E+00 1.55E+00
Non-alcoholic fatty liver disease DB92 Liver tissue 6.09E-01 4.62E-01 6.79E-01
Obesity related type 2 diabetes 5A11 Omental adipose tissue 1.70E-02 -1.31E-01 -1.72E+00
Olive pollen allergy CA08.00 Peripheral blood 7.84E-01 1.24E-01 1.68E-01
Oral cancer 2B6E Oral tissue 1.65E-02 -3.30E-01 -3.05E-01
Osteoarthritis FA00-FA0Z Synovial tissue 2.17E-01 1.48E+00 7.70E-01
Osteoporosis FB83.1 Bone marrow 5.62E-01 -2.94E-01 -4.39E-01
Ovarian cancer 2C73 Ovarian tissue 1.57E-03 1.77E+00 1.92E+00
Pancreatic cancer 2C10 Pancreas 2.34E-01 -8.50E-03 -8.16E-03
Parkinson's disease 8A00.0 Substantia nigra tissue 1.66E-02 -5.56E-01 -1.14E+00
Pediatric respiratory syncytial virus infection CA40.11 Peripheral blood 3.00E-02 3.83E-02 3.01E-01
Pituitary cancer 2D12 Pituitary tissue 6.55E-02 2.29E-01 4.73E-01
Pituitary gonadotrope tumour 2D12 Pituitary tissue 6.55E-01 7.51E-02 2.72E-01
Polycystic ovary syndrome 5A80.1 Vastus lateralis muscle 8.49E-02 3.71E-02 2.42E-01
Polycythemia vera 2A20.4 Whole blood 9.61E-07 -1.42E-01 -5.35E-01
Pompe disease 5C51.3 Biceps muscle 5.49E-01 7.34E-02 4.42E-01
Preterm birth KA21.4Z Myometrium 4.11E-01 -3.83E-02 -8.90E-02
Prostate cancer 2C82 Prostate 4.65E-01 5.87E-01 4.95E-01
Psoriasis EA90 Skin 4.78E-24 -8.41E-01 -1.48E+00
Rectal cancer 2B92 Rectal colon tissue 1.64E-01 1.37E-01 8.34E-01
Renal cancer 2C90-2C91 Kidney 1.58E-01 -3.18E-01 -4.08E-01
Retinoblastoma 2D02.2 Uvea 3.62E-09 2.13E+00 8.90E+00
Rheumatoid arthritis FA20 Synovial tissue 1.70E-03 1.40E+00 2.05E+00
Rhinovirus infection CA42.1 Nasal epithelium tissue 3.21E-01 6.64E-02 1.75E-01
Schizophrenia 6A20 Prefrontal cortex 4.27E-01 5.54E-02 9.09E-02
Schizophrenia 6A20 Superior temporal cortex 6.14E-01 -1.76E-02 -5.50E-02
Scleroderma 4A42.Z Whole blood 3.94E-01 1.16E-01 6.03E-01
Seizure 8A60-8A6Z Whole blood 3.32E-01 1.00E-01 3.79E-01
Sensitive skin EK0Z Skin 1.70E-01 -1.51E-01 -7.57E-01
Sepsis with septic shock 1G41 Whole blood 6.08E-08 -1.36E-01 -3.20E-01
Shwachman-Diamond syndrome 3A70.0 Bone marrow 7.68E-03 -6.97E-01 -1.71E+00
Sickle cell disease 3A51.0-3A51.3 Peripheral blood 1.74E-02 9.03E-02 6.85E-01
Simpson golabi behmel syndrome LD2C Adipose tissue 9.72E-01 -1.52E-02 -4.12E-02
Sjogren's syndrome 4A43.2 Salivary gland tissue 5.60E-01 1.23E-01 5.18E-01
Skin cancer 2C30-2C3Z Skin 1.02E-02 -1.58E-01 -2.20E-01
Thrombocythemia 3B63 Whole blood 1.29E-08 -2.83E-01 -9.66E-01
Thrombocytopenia 3B64 Whole blood 6.85E-01 1.41E-01 2.16E-01
Thyroid cancer 2D10 Thyroid 1.30E-02 -8.75E-02 -2.42E-01
Tibial muscular dystrophy 8C75 Muscle tissue 1.41E-04 6.49E-01 1.49E+00
Tuberous sclerosis complex LD2D.2 Perituberal tissue 8.13E-02 -2.39E-01 -2.54E+00
Type 2 diabetes 5A11 Liver tissue 8.29E-01 -7.63E-02 -1.47E-01
Ureter cancer 2C92 Urothelium 9.51E-01 4.75E-02 2.36E-01
Uterine cancer 2C78 Endometrium tissue 1.11E-03 2.32E-01 2.54E-01
Vitiligo ED63.0 Skin 8.11E-01 1.96E-02 9.98E-02
------------------------------------------------------------------------------------
⏷ Show the Full List of DME Expression Under 107 Diseases

References

1 Structural and enzymatic characterization of human recombinant GDP-D-mannose-4,6-dehydratase. FEBS Lett. 1999 Aug 13;456(3):370-4.