General Information of Drug-Metabolizing Enzyme (DME) (ID: DE97WM8)

DME Name NADP-dependent malic enzyme (ME1)
Synonyms NADP-specific-malic enzyme; Malic enzyme 1 NADP-specific; Malic enzyme 1; ME1; NADP-ME
Gene Name ME1
UniProt ID
MAOX_HUMAN
INTEDE ID
DME0504
3D Structure
Download
2D Sequence (FASTA)
Download
3D Structure (PDB)
Download
Gene ID
4199
EC Number EC: 1.1.1.40
Oxidoreductase
CH-OH donor oxidoreductase
NAD/NADP oxidoreductase
EC: 1.1.1.40
Lineage Species: Homo sapiens
Kingdom: Metazoa
Phylum: Chordata
Class: Mammalia
Order: Primates
Family: Hominidae
Genus: Homo
Species: Homo sapiens
Sequence
MEPEAPRRRHTHQRGYLLTRNPHLNKDLAFTLEERQQLNIHGLLPPSFNSQEIQVLRVVK
NFEHLNSDFDRYLLLMDLQDRNEKLFYRVLTSDIEKFMPIVYTPTVGLACQQYSLVFRKP
RGLFITIHDRGHIASVLNAWPEDVIKAIVVTDGERILGLGDLGCNGMGIPVGKLALYTAC
GGMNPQECLPVILDVGTENEELLKDPLYIGLRQRRVRGSEYDDFLDEFMEAVSSKYGMNC
LIQFEDFANVNAFRLLNKYRNQYCTFNDDIQGTASVAVAGLLAALRITKNKLSDQTILFQ
GAGEAALGIAHLIVMALEKEGLPKEKAIKKIWLVDSKGLIVKGRASLTQEKEKFAHEHEE
MKNLEAIVQEIKPTALIGVAAIGGAFSEQILKDMAAFNERPIIFALSNPTSKAECSAEQC
YKITKGRAIFASGSPFDPVTLPNGQTLYPGQGNNSYVFPGVALGVVACGLRQITDNIFLT
TAEVIAQQVSDKHLEEGRLYPPLNTIRDVSLKIAEKIVKDAYQEKTATVYPEPQNKEAFV
RSQMYSTDYDQILPDCYSWPEEVQKIQTKVDQ
Function This enzyme is reversible oxidative decarboxylation of malate to pyruvate, links the glycolytic and citric acid cycles.
KEGG Pathway
Carbon metabolism (hsa01200 )
Metabolic pathways (hsa01100 )
PPAR signaling pathway (hsa03320 )
Pyruvate metabolism (hsa00620 )
Reactome Pathway
Pyruvate metabolism (R-HSA-70268 )
PPARA activates gene expression (R-HSA-1989781 )

Molecular Interaction Atlas (MIA) of This DME

Molecular Interaction Atlas (MIA) Jump to Detail Molecular Interaction Atlas of This DME
1 Investigative Drug(s) Metabolized by This DME
Drug Name Drug ID Indication ICD 11 Highest Status REF
Malate DMMCJLH N. A. N. A. Investigative [1]

Molecular Expression Atlas (MEA) of This DME

Molecular Expression Atlas (MEA) Jump to Detail Molecular Expression Atlas of This DME
Disease Name ICD 11 Studied Tissue p-value Fold-Change Z-score
Acute myelocytic leukaemia 2B33.1 Bone marrow 9.58E-02 1.93E-02 5.45E-02
Alopecia ED70 Skin from scalp 2.10E-02 1.87E-01 4.59E-01
Alzheimer's disease 8A20 Entorhinal cortex 6.42E-05 -1.46E-01 -5.22E-01
Ankylosing spondylitis FA92.0 Pheripheral blood 8.97E-01 -1.85E-02 -4.91E-02
Aortic stenosis BB70 Calcified aortic valve 5.35E-01 1.85E-01 1.80E-01
Apnea 7A40 Hyperplastic tonsil 4.53E-01 -6.75E-01 -1.13E+00
Arthropathy FA00-FA5Z Peripheral blood 1.23E-01 -1.96E-01 -5.99E-01
Asthma CA23 Nasal and bronchial airway 4.30E-06 1.35E+00 8.10E-01
Atopic dermatitis EA80 Skin 1.22E-03 -5.80E-01 -8.74E-01
Autism 6A02 Whole blood 5.87E-01 1.38E-02 3.83E-02
Autoimmune uveitis 9A96 Peripheral monocyte 5.86E-01 1.67E-01 3.06E-01
Autosomal dominant monocytopenia 4B04 Whole blood 3.23E-01 -7.71E-02 -5.27E-01
Bacterial infection of gingival 1C1H Gingival tissue 4.98E-21 -8.02E-01 -1.74E+00
Batten disease 5C56.1 Whole blood 9.49E-01 -2.16E-02 -1.70E-01
Behcet's disease 4A62 Peripheral blood 1.50E-01 2.34E-02 1.29E-01
Bipolar disorder 6A60-6A6Z Prefrontal cortex 8.81E-01 2.27E-02 1.03E-01
Bladder cancer 2C94 Bladder tissue 2.85E-02 -9.32E-01 -9.55E-01
Breast cancer 2C60-2C6Z Breast tissue 7.45E-24 -1.33E+00 -7.33E-01
Cardioembolic stroke 8B11.20 Whole blood 3.85E-03 1.37E-01 4.73E-01
Cervical cancer 2C77 Cervical tissue 1.48E-03 -1.86E+00 -1.34E+00
Childhood onset rheumatic disease FA20.Z Peripheral blood 5.90E-01 -6.89E-03 -1.80E-02
Chronic hepatitis C 1E51.1 Whole blood 7.30E-02 -1.60E-01 -2.00E-01
Chronic obstructive pulmonary disease CA22 Lung tissue 5.04E-01 -5.42E-02 -1.06E-01
Chronic obstructive pulmonary disease CA22 Small airway epithelium 3.72E-06 9.27E-01 7.71E-01
Chronic rhinosinusitis CA0A Sinus mucosa tissue 7.35E-01 2.76E-02 4.21E-02
Colon cancer 2B90 Colon tissue 6.98E-27 9.52E-01 1.10E+00
Coronary artery disease BA80-BA8Z Peripheral blood 9.79E-03 -2.91E-01 -1.77E+00
Diffuse large B-cell lymphoma 2A81 Tonsil tissue 8.05E-01 -2.19E-03 -4.76E-03
Endometriosis GA10 Endometrium tissue 6.95E-01 -9.56E-02 -5.74E-02
Familial hypercholesterolemia 5C80.00 Peripheral blood 5.44E-01 -5.96E-02 -2.12E-01
Familial hypercholesterolemia 5C80.00 Whole blood 3.00E-04 6.60E-01 2.01E+00
Gastric cancer 2B72 Gastric tissue 9.98E-01 -2.17E-01 -1.85E-01
Glioblastopma 2A00.00 Nervous tissue 9.51E-88 -1.34E+00 -2.19E+00
Glioma 2A00.0Y-2A00.0Z Brain stem tissue 5.99E-01 -9.70E-02 -1.59E+00
Glioma 2A00.0Y-2A00.0Z White matter tissue 9.53E-01 3.08E-01 2.93E-01
Head and neck cancer 2D42 Head and neck tissue 9.05E-01 -4.31E-01 -2.95E-01
HIV-associated neurocognitive impairment 8A2Y-8A2Z White matter tissue 1.73E-01 2.05E-01 4.39E-01
Huntington's disease 8A01.10 Whole blood 4.54E-01 2.55E-02 1.93E-01
Idiopathic pulmonary fibrosis CB03.4 Lung tissue 8.93E-01 -2.62E-01 -4.87E-01
Immunodeficiency 4A00-4A20 Peripheral blood 2.98E-01 -5.74E-02 -5.91E-01
Influenza 1E30 Whole blood 6.17E-01 -6.89E-01 -9.53E-01
Interstitial cystitis GC00.3 Bladder tissue 8.03E-01 -1.10E-01 -2.00E-01
Intracranial aneurysm 8B01.0 Intracranial artery 1.10E-03 8.78E-01 2.01E+00
Irritable bowel syndrome DD91.0 Rectal colon tissue 2.91E-03 3.11E-01 5.52E-01
Ischemic stroke 8B11 Peripheral blood 8.23E-01 -7.72E-02 -4.19E-01
Juvenile idiopathic arthritis FA24 Peripheral blood 2.32E-04 3.00E-01 6.81E-01
Lateral sclerosis 8B60.4 Skin 4.67E-01 -1.64E-02 -1.44E-02
Lateral sclerosis 8B60.4 Cervical spinal cord 5.45E-01 1.99E-01 2.35E-01
Liver cancer 2C12.0 Liver tissue 1.80E-03 5.41E-01 5.31E-01
Liver failure DB99.7-DB99.8 Liver tissue 3.20E-02 1.05E+00 8.50E-01
Lung cancer 2C25 Lung tissue 2.74E-06 1.28E-01 2.82E-01
Lupus erythematosus 4A40 Whole blood 1.69E-03 -2.08E-01 -4.33E-01
Major depressive disorder 6A70-6A7Z Hippocampus 3.29E-01 -9.45E-02 -4.86E-01
Major depressive disorder 6A70-6A7Z Whole blood 2.20E-01 4.43E-02 2.22E-01
Melanoma 2C30 Skin 6.68E-08 -1.97E+00 -1.65E+00
Multiple myeloma 2A83.1 Peripheral blood 5.92E-01 -2.43E-02 -1.39E-01
Multiple myeloma 2A83.1 Bone marrow 5.45E-01 -1.89E-01 -2.46E-01
Multiple sclerosis 8A40 Plasmacytoid dendritic cells 2.38E-01 0.00E+00 0.00E+00
Myelodysplastic syndrome 2A36-2A3Z Bone marrow 9.37E-04 5.01E-01 5.08E-01
Myelofibrosis 2A20.2 Whole blood 3.21E-01 5.82E-02 3.68E-01
Myocardial infarction BA41-BA50 Peripheral blood 1.55E-01 -5.41E-02 -5.87E-02
Myopathy 8C70.6 Muscle tissue 3.65E-02 -1.23E-01 -6.35E-01
Neonatal sepsis KA60 Whole blood 1.01E-14 5.18E-01 1.50E+00
Neuroectodermal tumour 2A00.11 Brain stem tissue 1.70E-06 -2.30E+00 -3.30E+00
Non-alcoholic fatty liver disease DB92 Liver tissue 2.57E-02 5.51E-01 2.57E+00
Obesity related type 2 diabetes 5A11 Omental adipose tissue 9.03E-01 2.76E-02 9.56E-02
Olive pollen allergy CA08.00 Peripheral blood 2.90E-01 1.57E+00 1.04E+00
Oral cancer 2B6E Oral tissue 9.22E-01 -1.85E-01 -1.48E-01
Osteoarthritis FA00-FA0Z Synovial tissue 6.30E-01 4.01E-02 6.50E-02
Osteoporosis FB83.1 Bone marrow 5.46E-01 -1.70E-01 -5.07E-01
Ovarian cancer 2C73 Ovarian tissue 2.54E-02 -1.19E+00 -1.07E+00
Pancreatic cancer 2C10 Pancreas 4.69E-01 3.10E-01 3.76E-01
Parkinson's disease 8A00.0 Substantia nigra tissue 3.80E-02 -3.37E-01 -8.07E-01
Pediatric respiratory syncytial virus infection CA40.11 Peripheral blood 2.34E-04 2.67E-01 9.60E-01
Pituitary cancer 2D12 Pituitary tissue 5.37E-03 5.58E-01 1.47E+00
Pituitary gonadotrope tumour 2D12 Pituitary tissue 1.32E-03 1.14E+00 2.13E+00
Polycystic ovary syndrome 5A80.1 Vastus lateralis muscle 6.16E-04 3.50E-01 1.28E+00
Polycythemia vera 2A20.4 Whole blood 7.19E-10 2.48E-01 1.30E+00
Pompe disease 5C51.3 Biceps muscle 4.47E-04 8.38E-01 1.48E+00
Preterm birth KA21.4Z Myometrium 4.98E-03 1.20E+00 4.34E+00
Prostate cancer 2C82 Prostate 9.42E-02 -2.33E-01 -2.47E-01
Psoriasis EA90 Skin 1.62E-02 2.64E-01 3.36E-01
Rectal cancer 2B92 Rectal colon tissue 6.56E-01 3.64E-01 5.98E-01
Renal cancer 2C90-2C91 Kidney 1.17E-06 1.27E+00 2.83E+00
Retinoblastoma 2D02.2 Uvea 7.48E-06 -2.91E+00 -7.18E+00
Rheumatoid arthritis FA20 Synovial tissue 1.22E-01 -2.87E-01 -4.65E-01
Rhinovirus infection CA42.1 Nasal epithelium tissue 2.52E-02 -1.69E-01 -4.91E-01
Schizophrenia 6A20 Prefrontal cortex 4.80E-02 -3.89E-01 -3.08E-01
Schizophrenia 6A20 Superior temporal cortex 5.30E-01 4.56E-02 3.62E-01
Scleroderma 4A42.Z Whole blood 1.91E-01 3.90E-01 9.84E-01
Seizure 8A60-8A6Z Whole blood 4.58E-01 -1.38E-01 -7.40E-01
Sensitive skin EK0Z Skin 7.31E-01 -1.35E-02 -4.10E-02
Sepsis with septic shock 1G41 Whole blood 6.96E-19 2.37E-01 7.64E-01
Shwachman-Diamond syndrome 3A70.0 Bone marrow 1.75E-02 5.55E-01 1.62E+00
Sickle cell disease 3A51.0-3A51.3 Peripheral blood 3.33E-03 6.75E-01 2.33E+00
Simpson golabi behmel syndrome LD2C Adipose tissue 4.85E-02 -1.48E-01 -1.47E+00
Sjogren's syndrome 4A43.2 Salivary gland tissue 1.54E-01 1.47E-01 7.99E-01
Skin cancer 2C30-2C3Z Skin 1.16E-79 -2.16E+00 -2.74E+00
Thrombocythemia 3B63 Whole blood 6.01E-03 1.14E-01 6.32E-01
Thrombocytopenia 3B64 Whole blood 3.95E-01 3.15E-01 8.13E-01
Thyroid cancer 2D10 Thyroid 3.97E-03 -2.29E-01 -4.65E-01
Tibial muscular dystrophy 8C75 Muscle tissue 3.59E-06 -8.09E-01 -2.86E+00
Tuberous sclerosis complex LD2D.2 Perituberal tissue 2.52E-01 -3.11E-01 -3.10E+00
Type 2 diabetes 5A11 Liver tissue 2.68E-01 -5.10E-02 -1.78E-01
Ureter cancer 2C92 Urothelium 4.40E-01 -3.58E-02 -1.35E-01
Uterine cancer 2C78 Endometrium tissue 7.16E-01 1.78E-02 1.35E-02
Vitiligo ED63.0 Skin 8.52E-01 -1.38E-01 -2.73E-01
------------------------------------------------------------------------------------
⏷ Show the Full List of DME Expression Under 107 Diseases

References

1 Structural characteristics of the nonallosteric human cytosolic malic enzyme. Biochim Biophys Acta. 2014 Oct;1844(10):1773-83.