Details of Drug-Metabolizing Enzyme (DME)

General Information of Drug-Metabolizing Enzyme (DME) (ID: DE9KJP3)

DME Name Arsenite methyltransferase (AS3MT)
Synonyms Methylarsonite methyltransferase; S-adenosyl-L-methionine:arsenic(III) methyltransferase; AS3MT; CYT19
Gene Name AS3MT
UniProt ID
AS3MT_HUMAN
INTEDE ID
DME0408
3D Structure
Download
2D Sequence (FASTA)
Download
3D Structure (PDB)
Download
Gene ID
57412
EC Number EC: 2.1.1.137
Transferase
Methylase
Methyltransferase
EC: 2.1.1.137
Lineage Species: Homo sapiens
Kingdom: Metazoa
Phylum: Chordata
Class: Mammalia
Order: Primates
Family: Hominidae
Genus: Homo
Species: Homo sapiens
Sequence
MAALRDAEIQKDVQTYYGQVLKRSADLQTNGCVTTARPVPKHIREALQNVHEEVALRYYG
CGLVIPEHLENCWILDLGSGSGRDCYVLSQLVGEKGHVTGIDMTKGQVEVAEKYLDYHME
KYGFQASNVTFIHGYIEKLGEAGIKNESHDIVVSNCVINLVPDKQQVLQEAYRVLKHGGE
LYFSDVYTSLELPEEIRTHKVLWGECLGGALYWKELAVLAQKIGFCPPRLVTANLITIQN
KELERVIGDCRFVSATFRLFKHSKTGPTKRCQVIYNGGITGHEKELMFDANFTFKEGEIV
EVDEETAAILKNSRFAQDFLIRPIGEKLPTSGGCSALELKDIITDPFKLAEESDSMKSRC
VPDAAGGCCGTKKSC
Function
This enzyme catalyzes the transfer of a methyl group from AdoMet to trivalent arsenicals producing methylated and dimethylated arsenicals. It methylates arsenite to form methylarsonate, Me-AsO(3)H(2), which is reduced by methylarsonate reductase to methylarsonite, Me-As(OH)2. Methylarsonite is also a substrate and it is converted into the much less toxic compound dimethylarsinate (cacodylate), Me(2)As(O)-OH.
Reactome Pathway
Methylation (R-HSA-156581 )

Molecular Interaction Atlas (MIA) of This DME

Molecular Interaction Atlas (MIA) Jump to Detail Molecular Interaction Atlas of This DME
1 Approved Drug(s) Metabolized by This DME
Drug Name Drug ID Indication ICD 11 Highest Status REF
Arsenic DMTL2Y1 N. A. N. A. Approved [1]

Molecular Expression Atlas (MEA) of This DME

Molecular Expression Atlas (MEA) Jump to Detail Molecular Expression Atlas of This DME
Disease Name ICD 11 Studied Tissue p-value Fold-Change Z-score
Acute myelocytic leukaemia 2B33.1 Bone marrow 5.27E-04 -8.66E-02 -4.65E-01
Alopecia ED70 Skin from scalp 6.76E-01 6.86E-02 1.69E-01
Alzheimer's disease 8A20 Entorhinal cortex 6.72E-03 9.91E-02 3.29E-01
Ankylosing spondylitis FA92.0 Pheripheral blood 8.18E-01 2.17E-02 1.78E-01
Aortic stenosis BB70 Calcified aortic valve 2.83E-01 -3.53E-01 -6.50E-01
Apnea 7A40 Hyperplastic tonsil 6.19E-01 8.92E-02 8.76E-01
Arthropathy FA00-FA5Z Peripheral blood 1.87E-01 -9.40E-02 -3.44E-01
Asthma CA23 Nasal and bronchial airway 6.12E-02 3.72E-01 4.35E-01
Atopic dermatitis EA80 Skin 2.28E-01 -4.72E-02 -1.75E-01
Autism 6A02 Whole blood 6.77E-01 -1.12E-02 -4.78E-02
Autoimmune uveitis 9A96 Peripheral monocyte 1.06E-01 3.50E-01 1.87E+00
Autosomal dominant monocytopenia 4B04 Whole blood 6.93E-03 -3.97E-01 -1.74E+00
Bacterial infection of gingival 1C1H Gingival tissue 1.44E-02 -1.33E-01 -3.78E-01
Batten disease 5C56.1 Whole blood 9.49E-01 -8.16E-02 -2.31E-01
Behcet's disease 4A62 Peripheral blood 3.48E-01 1.09E-01 4.27E-01
Bipolar disorder 6A60-6A6Z Prefrontal cortex 2.85E-02 1.76E-01 7.07E-01
Bladder cancer 2C94 Bladder tissue 1.30E-01 3.01E-01 5.78E-01
Breast cancer 2C60-2C6Z Breast tissue 2.70E-04 -1.96E-01 -3.25E-01
Cardioembolic stroke 8B11.20 Whole blood 6.71E-02 -1.26E-01 -3.70E-01
Cervical cancer 2C77 Cervical tissue 3.76E-01 5.97E-03 2.45E-02
Childhood onset rheumatic disease FA20.Z Peripheral blood 4.43E-01 3.81E-02 1.48E-01
Chronic hepatitis C 1E51.1 Whole blood 4.60E-01 1.15E-02 3.80E-02
Chronic obstructive pulmonary disease CA22 Lung tissue 4.62E-01 -4.31E-02 -9.89E-02
Chronic obstructive pulmonary disease CA22 Small airway epithelium 9.12E-01 1.52E-03 6.98E-03
Chronic rhinosinusitis CA0A Sinus mucosa tissue 3.41E-01 -3.79E-02 -1.61E-01
Colon cancer 2B90 Colon tissue 1.31E-03 1.65E-02 5.44E-02
Coronary artery disease BA80-BA8Z Peripheral blood 7.69E-01 -6.69E-02 -1.49E-01
Diffuse large B-cell lymphoma 2A81 Tonsil tissue 5.90E-01 2.10E-02 1.83E-01
Endometriosis GA10 Endometrium tissue 1.64E-01 -1.65E-01 -2.76E-01
Familial hypercholesterolemia 5C80.00 Peripheral blood 9.59E-01 -2.59E-02 -1.15E-01
Familial hypercholesterolemia 5C80.00 Whole blood 7.67E-01 7.02E-02 3.73E-01
Gastric cancer 2B72 Gastric tissue 7.74E-01 -1.39E-01 -1.49E-01
Glioblastopma 2A00.00 Nervous tissue 2.33E-17 2.05E-01 5.28E-01
Glioma 2A00.0Y-2A00.0Z Brain stem tissue 7.84E-01 6.35E-02 3.67E+00
Glioma 2A00.0Y-2A00.0Z White matter tissue 3.29E-01 -4.45E-01 -5.37E-01
Head and neck cancer 2D42 Head and neck tissue 2.81E-02 -1.99E-01 -4.96E-01
HIV-associated neurocognitive impairment 8A2Y-8A2Z White matter tissue 5.92E-01 -4.62E-02 -1.66E-01
Huntington's disease 8A01.10 Whole blood 8.85E-01 5.72E-03 2.23E-02
Idiopathic pulmonary fibrosis CB03.4 Lung tissue 7.52E-02 2.77E-01 7.58E-01
Immunodeficiency 4A00-4A20 Peripheral blood 4.12E-01 -2.12E-01 -1.60E+00
Influenza 1E30 Whole blood 7.28E-01 -3.47E-02 -1.91E-01
Interstitial cystitis GC00.3 Bladder tissue 2.52E-01 -1.12E-01 -4.95E-01
Intracranial aneurysm 8B01.0 Intracranial artery 1.05E-03 -5.48E-01 -1.80E+00
Irritable bowel syndrome DD91.0 Rectal colon tissue 2.46E-01 -4.48E-02 -1.13E-01
Ischemic stroke 8B11 Peripheral blood 5.99E-01 1.12E-01 7.10E-01
Juvenile idiopathic arthritis FA24 Peripheral blood 9.35E-01 -4.93E-02 -7.10E-02
Lateral sclerosis 8B60.4 Skin 9.12E-01 -2.62E-02 -3.78E-02
Lateral sclerosis 8B60.4 Cervical spinal cord 3.64E-01 3.22E-01 5.31E-01
Liver cancer 2C12.0 Liver tissue 5.83E-01 6.77E-02 8.57E-02
Liver failure DB99.7-DB99.8 Liver tissue 6.00E-07 -2.20E+00 -5.14E+00
Lung cancer 2C25 Lung tissue 9.42E-01 3.09E-02 6.54E-02
Lupus erythematosus 4A40 Whole blood 5.92E-03 3.09E-01 4.32E-01
Major depressive disorder 6A70-6A7Z Hippocampus 1.67E-01 5.25E-03 2.29E-02
Major depressive disorder 6A70-6A7Z Whole blood 1.21E-01 2.33E-01 3.59E-01
Melanoma 2C30 Skin 2.07E-03 -9.77E-01 -8.43E-01
Multiple myeloma 2A83.1 Peripheral blood 2.67E-01 2.04E-01 6.71E-01
Multiple myeloma 2A83.1 Bone marrow 8.40E-03 -3.16E-01 -1.03E+00
Multiple sclerosis 8A40 Plasmacytoid dendritic cells 7.81E-02 -3.59E-01 -6.00E-01
Myelodysplastic syndrome 2A36-2A3Z Bone marrow 3.80E-01 -7.48E-02 -1.71E-01
Myelofibrosis 2A20.2 Whole blood 6.28E-01 -4.32E-02 -2.18E-01
Myocardial infarction BA41-BA50 Peripheral blood 2.45E-02 -1.28E+00 -9.00E-01
Myopathy 8C70.6 Muscle tissue 3.57E-02 -3.06E-01 -9.40E-01
Neonatal sepsis KA60 Whole blood 5.04E-01 -3.44E-02 -1.32E-01
Neuroectodermal tumour 2A00.11 Brain stem tissue 1.49E-06 8.84E-01 2.89E+00
Non-alcoholic fatty liver disease DB92 Liver tissue 1.71E-01 1.09E-01 4.69E-01
Obesity related type 2 diabetes 5A11 Omental adipose tissue 8.80E-01 6.56E-02 1.64E-01
Olive pollen allergy CA08.00 Peripheral blood 3.85E-04 2.46E-01 4.42E+00
Oral cancer 2B6E Oral tissue 3.40E-05 -5.43E-01 -7.82E-01
Osteoarthritis FA00-FA0Z Synovial tissue 5.93E-01 3.21E-01 5.33E-01
Osteoporosis FB83.1 Bone marrow 3.18E-02 -4.10E-01 -1.74E+00
Ovarian cancer 2C73 Ovarian tissue 2.57E-03 -7.81E-01 -1.18E+00
Pancreatic cancer 2C10 Pancreas 4.52E-03 -5.73E-01 -1.07E+00
Parkinson's disease 8A00.0 Substantia nigra tissue 1.72E-01 1.50E-01 4.74E-01
Pediatric respiratory syncytial virus infection CA40.11 Peripheral blood 2.30E-01 -1.18E-02 -4.63E-02
Pituitary cancer 2D12 Pituitary tissue 1.83E-01 1.42E-01 4.29E-01
Pituitary gonadotrope tumour 2D12 Pituitary tissue 8.78E-01 -5.41E-02 -1.41E-01
Polycystic ovary syndrome 5A80.1 Vastus lateralis muscle 5.12E-02 -2.93E-01 -1.09E+00
Polycythemia vera 2A20.4 Whole blood 9.10E-01 3.16E-02 1.51E-01
Pompe disease 5C51.3 Biceps muscle 3.23E-01 2.57E-01 2.66E-01
Preterm birth KA21.4Z Myometrium 4.65E-01 -1.48E-02 -3.04E-02
Prostate cancer 2C82 Prostate 1.45E-03 1.34E+00 1.49E+00
Psoriasis EA90 Skin 9.28E-01 -1.57E-01 -2.41E-01
Rectal cancer 2B92 Rectal colon tissue 9.08E-01 -1.71E-01 -3.91E-01
Renal cancer 2C90-2C91 Kidney 4.07E-01 1.30E-01 3.19E-01
Retinoblastoma 2D02.2 Uvea 2.78E-01 3.92E-01 1.23E+00
Rheumatoid arthritis FA20 Synovial tissue 3.39E-02 2.38E-01 1.35E+00
Rhinovirus infection CA42.1 Nasal epithelium tissue 1.81E-02 -9.72E-02 -5.92E-01
Schizophrenia 6A20 Prefrontal cortex 1.99E-01 -5.44E-02 -1.25E-01
Schizophrenia 6A20 Superior temporal cortex 2.40E-01 -5.82E-02 -3.09E-01
Scleroderma 4A42.Z Whole blood 1.71E-02 -2.63E-01 -1.02E+00
Seizure 8A60-8A6Z Whole blood 5.06E-01 -2.77E-02 -1.57E-01
Sensitive skin EK0Z Skin 3.98E-01 -2.48E-01 -9.55E-01
Sepsis with septic shock 1G41 Whole blood 1.53E-03 -1.08E-01 -3.73E-01
Shwachman-Diamond syndrome 3A70.0 Bone marrow 8.80E-01 -3.28E-02 -1.13E-01
Sickle cell disease 3A51.0-3A51.3 Peripheral blood 5.48E-01 1.98E-02 1.67E-01
Simpson golabi behmel syndrome LD2C Adipose tissue 9.13E-01 -1.10E-01 -1.18E-01
Sjogren's syndrome 4A43.2 Salivary gland tissue 2.10E-01 2.36E-01 1.31E+00
Skin cancer 2C30-2C3Z Skin 2.42E-01 -1.59E-01 -1.78E-01
Thrombocythemia 3B63 Whole blood 4.92E-01 -2.99E-02 -1.49E-01
Thrombocytopenia 3B64 Whole blood 3.25E-01 -8.44E-01 -1.23E+00
Thyroid cancer 2D10 Thyroid 1.40E-31 -1.16E+00 -2.15E+00
Tibial muscular dystrophy 8C75 Muscle tissue 7.40E-03 -4.35E-01 -8.93E-01
Tuberous sclerosis complex LD2D.2 Perituberal tissue 4.72E-02 3.41E-01 8.97E-01
Type 2 diabetes 5A11 Liver tissue 5.24E-01 -2.92E-02 -6.86E-02
Ureter cancer 2C92 Urothelium 4.83E-02 7.43E-02 7.98E-01
Uterine cancer 2C78 Endometrium tissue 9.82E-01 -1.45E-01 -1.84E-01
Vitiligo ED63.0 Skin 1.56E-01 -8.79E-02 -3.03E-01
------------------------------------------------------------------------------------
⏷ Show the Full List of DME Expression Under 107 Diseases

References

1 Polymorphisms in arsenic(+III oxidation state) methyltransferase (AS3MT) predict gene expression of AS3MT as well as arsenic metabolism. Environ Health Perspect. 2011 Feb;119(2):182-8.