Details of Drug-Metabolizing Enzyme (DME)

General Information of Drug-Metabolizing Enzyme (DME) (ID: DEAHED0)

DME Name Choline dehydrogenase (CHDH)
Synonyms Mitochondrial choline dehydrogenase; CDH; CHD; CHDH
Gene Name CHDH
UniProt ID
CHDH_HUMAN
INTEDE ID
DME0101
3D Structure
Download
2D Sequence (FASTA)
Download
3D Structure (PDB)
Download
Gene ID
55349
EC Number EC: 1.1.99.1
Oxidoreductase
CH-OH donor oxidoreductase
CH-OH donor oxidoreductase
EC: 1.1.99.1
Lineage Species: Homo sapiens
Kingdom: Metazoa
Phylum: Chordata
Class: Mammalia
Order: Primates
Family: Hominidae
Genus: Homo
Species: Homo sapiens
Sequence
MWCLLRGLGRPGALARGALGQQQSLGARALASAGSESRDEYSYVVVGAGSAGCVLAGRLT
EDPAERVLLLEAGPKDVLAGSKRLSWKIHMPAALVANLCDDRYNWCYHTEVQRGLDGRVL
YWPRGRVWGGSSSLNAMVYVRGHAEDYERWQRQGARGWDYAHCLPYFRKAQGHELGASRY
RGADGPLRVSRGKTNHPLHCAFLEATQQAGYPLTEDMNGFQQEGFGWMDMTIHEGKRWSA
ACAYLHPALSRTNLKAEAETLVSRVLFEGTRAVGVEYVKNGQSHRAYASKEVILSGGAIN
SPQLLMLSGIGNADDLKKLGIPVVCHLPGVGQNLQDHLEIYIQQACTRPITLHSAQKPLR
KVCIGLEWLWKFTGEGATAHLETGGFIRSQPGVPHPDIQFHFLPSQVIDHGRVPTQQEAY
QVHVGPMRGTSVGWLKLRSANPQDHPVIQPNYLSTETDIEDFRLCVKLTREIFAQEALAP
FRGKELQPGSHIQSDKEIDAFVRAKADSAYHPSCTCKMGQPSDPTAVVDPQTRVLGVENL
RVVDASIMPSMVSGNLNAPTIMIAEKAADIIKGQPALWDKDVPVYKPRTLATQR
Function This enzyme participates in glycine, serine and threonine metabolism.
KEGG Pathway
Glycine, serine and threonine metabolism (hsa00260 )
Metabolic pathways (hsa01100 )
Reactome Pathway
Choline catabolism (R-HSA-6798163 )

Molecular Interaction Atlas (MIA) of This DME

Molecular Interaction Atlas (MIA) Jump to Detail Molecular Interaction Atlas of This DME
1 Approved Drug(s) Metabolized by This DME
Drug Name Drug ID Indication ICD 11 Highest Status REF
Choline salicylate DM8P137 Inflammation 1A00-CA43.1 Approved [1]
1 Investigative Drug(s) Metabolized by This DME
Drug Name Drug ID Indication ICD 11 Highest Status REF
CHOLINE DM5D9YK Insomnia 7A00-7A0Z Investigative [1]

Molecular Expression Atlas (MEA) of This DME

Molecular Expression Atlas (MEA) Jump to Detail Molecular Expression Atlas of This DME
Disease Name ICD 11 Studied Tissue p-value Fold-Change Z-score
Acute myelocytic leukaemia 2B33.1 Bone marrow 3.94E-03 -4.09E-02 -1.92E-01
Alopecia ED70 Skin from scalp 1.23E-01 1.23E-01 3.12E-01
Alzheimer's disease 8A20 Entorhinal cortex 4.51E-08 2.82E-01 7.60E-01
Ankylosing spondylitis FA92.0 Pheripheral blood 8.60E-01 -6.08E-03 -4.79E-02
Aortic stenosis BB70 Calcified aortic valve 5.33E-01 2.52E-01 4.00E-01
Apnea 7A40 Hyperplastic tonsil 9.19E-01 -1.43E-01 -7.71E-01
Arthropathy FA00-FA5Z Peripheral blood 3.02E-01 4.19E-02 1.90E-01
Asthma CA23 Nasal and bronchial airway 7.87E-11 5.50E-01 9.77E-01
Atopic dermatitis EA80 Skin 1.66E-05 3.98E-01 1.33E+00
Autism 6A02 Whole blood 1.06E-01 -1.07E-01 -5.03E-01
Autoimmune uveitis 9A96 Peripheral monocyte 7.29E-02 -9.55E-02 -6.90E-01
Autosomal dominant monocytopenia 4B04 Whole blood 3.46E-01 -2.78E-02 -2.05E-01
Bacterial infection of gingival 1C1H Gingival tissue 7.99E-01 1.81E-02 5.82E-02
Batten disease 5C56.1 Whole blood 2.05E-01 1.32E-01 8.48E-01
Behcet's disease 4A62 Peripheral blood 3.37E-01 5.82E-02 3.61E-01
Bipolar disorder 6A60-6A6Z Prefrontal cortex 4.98E-02 9.99E-02 6.01E-01
Bladder cancer 2C94 Bladder tissue 1.06E-05 3.53E-01 2.65E+00
Breast cancer 2C60-2C6Z Breast tissue 6.53E-04 -1.79E-01 -3.83E-01
Cardioembolic stroke 8B11.20 Whole blood 7.97E-01 -5.33E-02 -2.72E-01
Cervical cancer 2C77 Cervical tissue 3.84E-02 1.22E-01 4.76E-01
Childhood onset rheumatic disease FA20.Z Peripheral blood 3.07E-01 1.11E-01 3.84E-01
Chronic hepatitis C 1E51.1 Whole blood 1.90E-02 1.72E-01 1.31E+00
Chronic obstructive pulmonary disease CA22 Lung tissue 1.14E-01 -1.42E-01 -4.89E-01
Chronic obstructive pulmonary disease CA22 Small airway epithelium 2.53E-05 2.88E-01 1.07E+00
Chronic rhinosinusitis CA0A Sinus mucosa tissue 8.32E-02 2.68E-01 2.44E+00
Colon cancer 2B90 Colon tissue 2.68E-25 3.76E-01 1.14E+00
Coronary artery disease BA80-BA8Z Peripheral blood 4.04E-01 -2.82E-02 -2.20E-01
Diffuse large B-cell lymphoma 2A81 Tonsil tissue 2.82E-01 -1.53E-01 -2.61E-01
Endometriosis GA10 Endometrium tissue 3.50E-01 -1.79E-01 -5.06E-01
Familial hypercholesterolemia 5C80.00 Peripheral blood 9.10E-01 2.83E-02 1.26E-01
Familial hypercholesterolemia 5C80.00 Whole blood 2.48E-01 -1.46E-01 -5.77E-01
Gastric cancer 2B72 Gastric tissue 7.08E-01 -7.91E-02 -2.21E-01
Glioblastopma 2A00.00 Nervous tissue 1.01E-15 -1.77E-01 -4.47E-01
Glioma 2A00.0Y-2A00.0Z Brain stem tissue 2.66E-01 -4.55E-01 -1.54E+00
Glioma 2A00.0Y-2A00.0Z White matter tissue 6.28E-01 1.99E-01 2.39E-01
Head and neck cancer 2D42 Head and neck tissue 3.61E-01 -1.73E-03 -8.41E-03
HIV-associated neurocognitive impairment 8A2Y-8A2Z White matter tissue 6.10E-02 1.77E-01 4.87E-01
Huntington's disease 8A01.10 Whole blood 5.40E-01 2.34E-02 2.00E-01
Idiopathic pulmonary fibrosis CB03.4 Lung tissue 3.15E-01 -7.66E-02 -2.96E-01
Immunodeficiency 4A00-4A20 Peripheral blood 4.73E-01 -3.65E-02 -2.71E-01
Influenza 1E30 Whole blood 2.40E-01 9.01E-02 4.07E-01
Interstitial cystitis GC00.3 Bladder tissue 1.21E-01 -1.95E-01 -1.73E+00
Intracranial aneurysm 8B01.0 Intracranial artery 1.00E+00 3.37E-02 1.17E-01
Irritable bowel syndrome DD91.0 Rectal colon tissue 1.07E-01 -1.19E-01 -3.34E-01
Ischemic stroke 8B11 Peripheral blood 4.93E-01 -5.72E-02 -2.85E-01
Juvenile idiopathic arthritis FA24 Peripheral blood 3.27E-01 -8.65E-05 -3.35E-04
Lateral sclerosis 8B60.4 Skin 3.70E-01 9.49E-02 3.33E-01
Lateral sclerosis 8B60.4 Cervical spinal cord 3.75E-01 1.30E-01 5.61E-01
Liver cancer 2C12.0 Liver tissue 5.43E-01 2.14E-01 3.00E-01
Liver failure DB99.7-DB99.8 Liver tissue 4.12E-05 -1.21E+00 -3.65E+00
Lung cancer 2C25 Lung tissue 1.84E-04 1.64E-01 4.56E-01
Lupus erythematosus 4A40 Whole blood 7.10E-05 -1.40E-01 -4.11E-01
Major depressive disorder 6A70-6A7Z Hippocampus 1.84E-01 1.82E-02 1.09E-01
Major depressive disorder 6A70-6A7Z Whole blood 3.41E-01 6.37E-02 2.95E-01
Melanoma 2C30 Skin 1.09E-03 -4.16E-01 -6.37E-01
Multiple myeloma 2A83.1 Peripheral blood 6.07E-01 8.99E-03 3.91E-02
Multiple myeloma 2A83.1 Bone marrow 9.98E-01 -2.95E-03 -1.56E-02
Multiple sclerosis 8A40 Plasmacytoid dendritic cells 9.44E-01 3.11E-02 9.88E-02
Myelodysplastic syndrome 2A36-2A3Z Bone marrow 5.53E-01 -1.31E-02 -1.02E-01
Myelofibrosis 2A20.2 Whole blood 2.04E-02 1.93E-01 1.52E+00
Myocardial infarction BA41-BA50 Peripheral blood 8.31E-01 4.28E-03 1.44E-02
Myopathy 8C70.6 Muscle tissue 4.86E-03 -3.35E-01 -1.24E+00
Neonatal sepsis KA60 Whole blood 8.11E-01 2.42E-02 9.87E-02
Neuroectodermal tumour 2A00.11 Brain stem tissue 5.16E-04 -5.26E-01 -1.82E+00
Non-alcoholic fatty liver disease DB92 Liver tissue 1.16E-01 -6.88E-02 -5.66E-01
Obesity related type 2 diabetes 5A11 Omental adipose tissue 2.95E-01 -2.96E-02 -2.17E-01
Olive pollen allergy CA08.00 Peripheral blood 6.63E-02 1.04E-01 8.32E-01
Oral cancer 2B6E Oral tissue 7.95E-10 -7.77E-01 -1.63E+00
Osteoarthritis FA00-FA0Z Synovial tissue 4.04E-02 -2.67E-01 -9.65E-01
Osteoporosis FB83.1 Bone marrow 4.96E-02 1.40E-01 1.89E+00
Ovarian cancer 2C73 Ovarian tissue 1.76E-01 1.63E-01 3.50E-01
Pancreatic cancer 2C10 Pancreas 1.35E-01 -3.55E-01 -7.24E-01
Parkinson's disease 8A00.0 Substantia nigra tissue 2.80E-02 2.18E-01 9.33E-01
Pediatric respiratory syncytial virus infection CA40.11 Peripheral blood 3.22E-01 1.95E-05 1.56E-04
Pituitary cancer 2D12 Pituitary tissue 4.41E-05 -1.17E+00 -2.36E+00
Pituitary gonadotrope tumour 2D12 Pituitary tissue 5.38E-05 -1.05E+00 -2.43E+00
Polycystic ovary syndrome 5A80.1 Vastus lateralis muscle 1.84E-01 -5.42E-02 -2.84E-01
Polycythemia vera 2A20.4 Whole blood 6.36E-10 1.73E-01 1.41E+00
Pompe disease 5C51.3 Biceps muscle 8.07E-01 -1.41E-01 -5.18E-01
Preterm birth KA21.4Z Myometrium 7.41E-01 -3.89E-02 -3.50E-01
Prostate cancer 2C82 Prostate 1.41E-04 6.55E-01 1.08E+00
Psoriasis EA90 Skin 1.09E-10 -3.09E-01 -9.88E-01
Rectal cancer 2B92 Rectal colon tissue 2.10E-02 8.62E-02 7.04E-01
Renal cancer 2C90-2C91 Kidney 3.98E-02 -5.45E-01 -4.61E-01
Retinoblastoma 2D02.2 Uvea 5.26E-01 -7.74E-02 -4.72E-01
Rheumatoid arthritis FA20 Synovial tissue 1.24E-02 2.17E-01 1.02E+00
Rhinovirus infection CA42.1 Nasal epithelium tissue 8.55E-01 -3.07E-03 -1.95E-02
Schizophrenia 6A20 Prefrontal cortex 8.74E-01 3.67E-02 8.98E-02
Schizophrenia 6A20 Superior temporal cortex 5.84E-01 -2.92E-02 -2.77E-01
Scleroderma 4A42.Z Whole blood 3.62E-05 2.02E-01 1.99E+00
Seizure 8A60-8A6Z Whole blood 3.48E-01 -1.14E-01 -8.56E-01
Sensitive skin EK0Z Skin 1.79E-01 -1.55E-01 -1.03E+00
Sepsis with septic shock 1G41 Whole blood 2.90E-04 8.62E-02 3.28E-01
Shwachman-Diamond syndrome 3A70.0 Bone marrow 4.33E-01 9.31E-02 2.33E-01
Sickle cell disease 3A51.0-3A51.3 Peripheral blood 4.86E-01 -5.54E-02 -3.11E-01
Simpson golabi behmel syndrome LD2C Adipose tissue 9.09E-02 1.46E-01 4.46E+00
Sjogren's syndrome 4A43.2 Salivary gland tissue 3.14E-01 2.12E-02 1.04E-01
Skin cancer 2C30-2C3Z Skin 9.38E-19 -3.26E-01 -8.52E-01
Thrombocythemia 3B63 Whole blood 6.58E-01 1.30E-01 9.10E-01
Thrombocytopenia 3B64 Whole blood 9.87E-01 -2.42E-01 -2.19E+00
Thyroid cancer 2D10 Thyroid 4.45E-01 -5.46E-02 -1.43E-01
Tibial muscular dystrophy 8C75 Muscle tissue 6.42E-07 -3.29E-01 -2.05E+00
Tuberous sclerosis complex LD2D.2 Perituberal tissue 1.94E-01 3.47E-01 8.85E-01
Type 2 diabetes 5A11 Liver tissue 5.76E-01 2.41E-01 5.12E-01
Ureter cancer 2C92 Urothelium 6.25E-01 -4.42E-02 -1.65E-01
Uterine cancer 2C78 Endometrium tissue 1.54E-01 -1.34E-01 -3.23E-01
Vitiligo ED63.0 Skin 9.92E-01 5.41E-02 1.26E-01
------------------------------------------------------------------------------------
⏷ Show the Full List of DME Expression Under 107 Diseases

References

1 Usual choline and betaine dietary intake and incident coronary heart disease: the atherosclerosis risk in communities (ARIC) study. BMC Cardiovasc Disord. 2007 Jul 13;7:20.