Details of Drug-Metabolizing Enzyme (DME)

General Information of Drug-Metabolizing Enzyme (DME) (ID: DEAMVR3)

DME Name Dehydropeptidase-I (DPEP1)
Synonyms Microsomal dipeptidase; RDP; Renal dipeptidase; Dipeptidase 1; MDP; hRDP; DPEP1
Gene Name DPEP1
UniProt ID
DPEP1_HUMAN
INTEDE ID
DME0117
3D Structure
Download
2D Sequence (FASTA)
Download
3D Structure (PDB)
Download
Gene ID
1800
EC Number EC: 3.4.13.19
Hydrolases
Peptidase
Dipeptidase
EC: 3.4.13.19
Lineage Species: Homo sapiens
Kingdom: Metazoa
Phylum: Chordata
Class: Mammalia
Order: Primates
Family: Hominidae
Genus: Homo
Species: Homo sapiens
Sequence
MWSGWWLWPLVAVCTADFFRDEAERIMRDSPVIDGHNDLPWQLLDMFNNRLQDERANLTT
LAGTHTNIPKLRAGFVGGQFWSVYTPCDTQNKDAVRRTLEQMDVVHRMCRMYPETFLYVT
SSAGIRQAFREGKVASLIGVEGGHSIDSSLGVLRALYQLGMRYLTLTHSCNTPWADNWLV
DTGDSEPQSQGLSPFGQRVVKELNRLGVLIDLAHVSVATMKATLQLSRAPVIFSHSSAYS
VCASRRNVPDDVLRLVKQTDSLVMVNFYNNYISCTNKANLSQVADHLDHIKEVAGARAVG
FGGDFDGVPRVPEGLEDVSKYPDLIAELLRRNWTEAEVKGALADNLLRVFEAVEQASNLT
QAPEEEPIPLDQLGGSCRTHYGYSSGASSLHRHWGLLLASLAPLVLCLSLL
Function This enzyme hydrolyzes a wide range of dipeptides. It implicated in the renal metabolism of glutathione and its conjugates.
Reactome Pathway
Synthesis of Leukotrienes (LT) and Eoxins (EX) (R-HSA-2142691 )
Aflatoxin activation and detoxification (R-HSA-5423646 )

Molecular Interaction Atlas (MIA) of This DME

Molecular Interaction Atlas (MIA) Jump to Detail Molecular Interaction Atlas of This DME
1 Approved Drug(s) Metabolized by This DME
Drug Name Drug ID Indication ICD 11 Highest Status REF
Doripenem DM9UCJK Cholecystitis Approved [2]

Molecular Expression Atlas (MEA) of This DME

Molecular Expression Atlas (MEA) Jump to Detail Molecular Expression Atlas of This DME
Disease Name ICD 11 Studied Tissue p-value Fold-Change Z-score
Acute myelocytic leukaemia 2B33.1 Bone marrow 6.80E-02 7.35E-02 2.79E-01
Alopecia ED70 Skin from scalp 2.04E-02 -1.19E-01 -2.83E-01
Alzheimer's disease 8A20 Entorhinal cortex 4.64E-01 -8.23E-03 -5.54E-02
Ankylosing spondylitis FA92.0 Pheripheral blood 4.63E-02 1.40E-01 1.22E+00
Aortic stenosis BB70 Calcified aortic valve 7.36E-01 7.58E-02 1.01E-01
Apnea 7A40 Hyperplastic tonsil 3.18E-01 3.39E-02 1.51E-01
Arthropathy FA00-FA5Z Peripheral blood 3.48E-01 1.21E-02 7.26E-02
Asthma CA23 Nasal and bronchial airway 1.85E-04 -2.05E-01 -5.05E-01
Atopic dermatitis EA80 Skin 6.51E-04 1.64E-01 9.13E-01
Autism 6A02 Whole blood 4.15E-01 2.46E-02 1.02E-01
Autoimmune uveitis 9A96 Peripheral monocyte 1.40E-01 -8.77E-02 -8.25E-01
Autosomal dominant monocytopenia 4B04 Whole blood 4.53E-01 5.08E-02 3.33E-01
Bacterial infection of gingival 1C1H Gingival tissue 5.68E-16 3.96E-01 1.47E+00
Batten disease 5C56.1 Whole blood 4.31E-01 2.25E-02 1.94E-01
Behcet's disease 4A62 Peripheral blood 3.53E-01 7.31E-02 3.98E-01
Bipolar disorder 6A60-6A6Z Prefrontal cortex 2.18E-01 -6.53E-02 -3.83E-01
Bladder cancer 2C94 Bladder tissue 3.85E-05 3.99E-01 2.77E+00
Breast cancer 2C60-2C6Z Breast tissue 5.02E-23 2.07E-01 7.55E-01
Cardioembolic stroke 8B11.20 Whole blood 9.91E-01 -1.76E-02 -1.12E-01
Cervical cancer 2C77 Cervical tissue 8.73E-04 -2.19E-01 -9.29E-01
Childhood onset rheumatic disease FA20.Z Peripheral blood 8.54E-01 -1.32E-01 -4.59E-01
Chronic hepatitis C 1E51.1 Whole blood 8.87E-01 1.02E-01 5.95E-01
Chronic obstructive pulmonary disease CA22 Lung tissue 4.19E-01 4.51E-02 1.77E-01
Chronic obstructive pulmonary disease CA22 Small airway epithelium 5.28E-03 1.16E-01 4.59E-01
Chronic rhinosinusitis CA0A Sinus mucosa tissue 8.05E-01 -2.28E-01 -1.40E+00
Colon cancer 2B90 Colon tissue 4.21E-130 3.36E+00 4.42E+00
Coronary artery disease BA80-BA8Z Peripheral blood 8.99E-01 5.61E-02 4.46E-01
Diffuse large B-cell lymphoma 2A81 Tonsil tissue 4.62E-01 -1.07E-01 -5.00E-01
Endometriosis GA10 Endometrium tissue 8.53E-01 -2.25E-02 -8.12E-02
Familial hypercholesterolemia 5C80.00 Peripheral blood 6.49E-01 1.15E-01 9.74E-01
Familial hypercholesterolemia 5C80.00 Whole blood 2.41E-01 -7.83E-02 -4.05E-01
Gastric cancer 2B72 Gastric tissue 6.16E-02 2.00E-01 5.45E-01
Glioblastopma 2A00.00 Nervous tissue 1.20E-28 1.77E-01 6.46E-01
Glioma 2A00.0Y-2A00.0Z Brain stem tissue 3.37E-02 1.58E-01 3.04E+00
Glioma 2A00.0Y-2A00.0Z White matter tissue 3.07E-10 -1.19E+00 -4.71E+00
Head and neck cancer 2D42 Head and neck tissue 1.74E-02 5.91E-02 1.92E-01
HIV-associated neurocognitive impairment 8A2Y-8A2Z White matter tissue 1.91E-01 -9.82E-02 -5.70E-01
Huntington's disease 8A01.10 Whole blood 3.04E-01 1.23E-01 5.26E-01
Idiopathic pulmonary fibrosis CB03.4 Lung tissue 9.54E-01 2.88E-02 1.33E-01
Immunodeficiency 4A00-4A20 Peripheral blood 3.87E-01 1.91E-02 3.36E-01
Influenza 1E30 Whole blood 9.06E-02 4.60E-01 1.47E+00
Interstitial cystitis GC00.3 Bladder tissue 6.68E-04 5.04E-01 3.08E+00
Intracranial aneurysm 8B01.0 Intracranial artery 5.56E-01 -1.13E-01 -5.74E-01
Irritable bowel syndrome DD91.0 Rectal colon tissue 4.43E-01 9.76E-02 3.83E-01
Ischemic stroke 8B11 Peripheral blood 2.08E-02 1.62E-01 1.05E+00
Juvenile idiopathic arthritis FA24 Peripheral blood 2.61E-02 7.96E-02 2.92E-01
Lateral sclerosis 8B60.4 Skin 4.15E-01 -1.73E-01 -6.56E-01
Lateral sclerosis 8B60.4 Cervical spinal cord 6.01E-01 1.43E-01 3.05E-01
Liver cancer 2C12.0 Liver tissue 2.72E-07 -6.47E-02 -2.48E-01
Liver failure DB99.7-DB99.8 Liver tissue 3.50E-03 4.05E-01 2.24E+00
Lung cancer 2C25 Lung tissue 1.49E-07 1.42E-01 3.79E-01
Lupus erythematosus 4A40 Whole blood 6.63E-01 -1.73E-01 -3.73E-01
Major depressive disorder 6A70-6A7Z Hippocampus 7.05E-01 -2.42E-02 -1.65E-01
Major depressive disorder 6A70-6A7Z Whole blood 7.06E-02 4.81E-02 2.11E-01
Melanoma 2C30 Skin 2.01E-01 -1.83E-02 -3.13E-02
Multiple myeloma 2A83.1 Peripheral blood 1.84E-01 -2.34E-01 -1.16E+00
Multiple myeloma 2A83.1 Bone marrow 5.00E-01 -1.02E-01 -2.22E-01
Multiple sclerosis 8A40 Plasmacytoid dendritic cells 6.33E-02 1.41E-01 8.00E-01
Myelodysplastic syndrome 2A36-2A3Z Bone marrow 6.28E-01 -5.94E-02 -2.93E-01
Myelofibrosis 2A20.2 Whole blood 1.12E-01 -1.56E-01 -1.70E+00
Myocardial infarction BA41-BA50 Peripheral blood 1.47E-02 3.47E-01 8.44E-01
Myopathy 8C70.6 Muscle tissue 3.94E-02 -2.71E-01 -1.17E+00
Neonatal sepsis KA60 Whole blood 4.68E-01 -7.63E-03 -2.95E-02
Neuroectodermal tumour 2A00.11 Brain stem tissue 2.05E-01 1.30E-01 2.96E-01
Non-alcoholic fatty liver disease DB92 Liver tissue 9.71E-01 -3.30E-02 -1.58E-01
Obesity related type 2 diabetes 5A11 Omental adipose tissue 2.66E-01 1.99E-01 2.46E+00
Olive pollen allergy CA08.00 Peripheral blood 5.33E-01 2.83E-01 1.05E+00
Oral cancer 2B6E Oral tissue 1.58E-08 -5.09E-01 -1.42E+00
Osteoarthritis FA00-FA0Z Synovial tissue 2.28E-01 1.47E-02 6.30E-02
Osteoporosis FB83.1 Bone marrow 1.84E-02 4.90E-01 2.53E+00
Ovarian cancer 2C73 Ovarian tissue 5.30E-01 -6.04E-02 -1.85E-01
Pancreatic cancer 2C10 Pancreas 9.94E-03 -1.30E+00 -9.81E-01
Parkinson's disease 8A00.0 Substantia nigra tissue 7.44E-01 1.17E-01 4.11E-01
Pediatric respiratory syncytial virus infection CA40.11 Peripheral blood 7.43E-01 -3.49E-02 -2.07E-01
Pituitary cancer 2D12 Pituitary tissue 1.13E-01 1.57E-01 4.74E-01
Pituitary gonadotrope tumour 2D12 Pituitary tissue 6.51E-02 1.38E-01 5.45E-01
Polycystic ovary syndrome 5A80.1 Vastus lateralis muscle 8.21E-01 -3.02E-02 -1.37E-01
Polycythemia vera 2A20.4 Whole blood 4.06E-04 -8.10E-02 -6.78E-01
Pompe disease 5C51.3 Biceps muscle 4.53E-02 -1.14E-01 -7.43E-01
Preterm birth KA21.4Z Myometrium 6.72E-01 -3.97E-02 -1.40E-01
Prostate cancer 2C82 Prostate 3.76E-02 -3.95E-01 -4.65E-01
Psoriasis EA90 Skin 1.42E-09 -2.76E-01 -7.11E-01
Rectal cancer 2B92 Rectal colon tissue 1.64E-07 2.83E+00 6.21E+00
Renal cancer 2C90-2C91 Kidney 8.65E-04 -3.16E+00 -1.87E+00
Retinoblastoma 2D02.2 Uvea 2.06E-02 -2.36E-01 -1.07E+00
Rheumatoid arthritis FA20 Synovial tissue 4.86E-03 -4.89E-01 -1.38E+00
Rhinovirus infection CA42.1 Nasal epithelium tissue 9.84E-01 1.57E-02 8.88E-02
Schizophrenia 6A20 Prefrontal cortex 7.57E-01 -1.12E-03 -4.58E-03
Schizophrenia 6A20 Superior temporal cortex 4.27E-01 -9.10E-02 -8.01E-01
Scleroderma 4A42.Z Whole blood 2.02E-01 -2.02E-01 -9.78E-01
Seizure 8A60-8A6Z Whole blood 6.47E-01 -1.02E-02 -4.21E-02
Sensitive skin EK0Z Skin 6.65E-02 3.33E-01 1.40E+00
Sepsis with septic shock 1G41 Whole blood 9.77E-03 3.47E-02 1.35E-01
Shwachman-Diamond syndrome 3A70.0 Bone marrow 6.64E-01 -1.45E-02 -8.40E-02
Sickle cell disease 3A51.0-3A51.3 Peripheral blood 7.48E-01 -1.88E-02 -8.57E-02
Simpson golabi behmel syndrome LD2C Adipose tissue 4.24E-01 -2.20E-01 -1.74E+00
Sjogren's syndrome 4A43.2 Salivary gland tissue 5.14E-01 -2.29E-01 -2.78E+00
Skin cancer 2C30-2C3Z Skin 4.23E-12 -1.98E-01 -4.41E-01
Thrombocythemia 3B63 Whole blood 5.74E-02 -6.65E-02 -6.76E-01
Thrombocytopenia 3B64 Whole blood 7.33E-01 8.77E-02 3.14E-01
Thyroid cancer 2D10 Thyroid 1.20E-02 7.90E-02 2.22E-01
Tibial muscular dystrophy 8C75 Muscle tissue 4.22E-06 -6.76E-01 -2.50E+00
Tuberous sclerosis complex LD2D.2 Perituberal tissue 8.28E-01 9.85E-02 3.77E-01
Type 2 diabetes 5A11 Liver tissue 7.09E-01 -6.33E-02 -2.56E-01
Ureter cancer 2C92 Urothelium 4.28E-01 -6.25E-02 -1.82E-01
Uterine cancer 2C78 Endometrium tissue 4.02E-04 -1.93E-01 -3.99E-01
Vitiligo ED63.0 Skin 6.80E-02 3.67E-02 6.63E-01
------------------------------------------------------------------------------------
⏷ Show the Full List of DME Expression Under 107 Diseases

The Drug Therapeutic Target (DTT) Role of This DME

DME DTT Name Dehydropeptidase I (DPEP1) DTT Info
DME DTT Type Successful
1 Approved Drug(s) Targeting This DTT
Drug Name Drug ID Indication ICD 11 Highest Status REF
Cilastatin DME2H5T Bacteremia 1A73 Approved [1]

References

1 Pharmacokinetic study of pleural fluid penetration of carbapenem antibiotic agents in chemical pleurisy. Respir Med. 2006 Feb;100(2):324-31.
2 Disposition, metabolism, and excretion of [14C]doripenem after a single 500-milligram intravenous infusion in healthy men. Antimicrob Agents Chemother. 2008 Oct;52(10):3478-83.