Details of Drug-Metabolizing Enzyme (DME)

General Information of Drug-Metabolizing Enzyme (DME) (ID: DEAPJSO)

• DME Name: Microsomal glutathione S-transferase 1 (MGST1)
• Synonyms: Microsomal GST-1; Microsomal GST-I; GST12; MGST; MGST1
• Gene Name: MGST1
• UniProt ID: MGST1_HUMAN
• INTEDE ID: DME0621
• Gene ID: 4257
• EC Number:
  EC: 2.5.1.18
  Transferase
  Alkyl/aryl transferase
  Alkyl/aryl transferase
  EC: 2.5.1.18
• Lineage:
  Species: Homo sapiens
  Kingdom: Metazoa
  Phylum: Chordata
  Class: Mammalia
  Order: Primates
  Family: Hominidae
  Genus: Homo
  Species: Homo sapiens
• Sequence:
  MVDLTQVMDDEVFMAFASYATIILSKMMLMSTATAFYRLTRKVFANPEDCVAFGKGENAK
  KYLRTDDRVERVRRAHLNDLENIIPFLGIGLLYSLSGPDPSTAILHFRLFVGARIYHTIA
  YLTPLPQPNRALSFFVGYGVTLSMAYRLLKSKLYL
• Function: This enzyme has a wide substrate specificity and it conjugates of reduced glutathione to a wide number of exogenous and endogenous hydrophobic electrophiles.
• KEGG Pathway:
  Chemical carcinogenesis (hsa05204)
  Drug metabolism - cytochrome P450 (hsa00982)
  Drug metabolism - other enzymes (hsa00983)
  Fluid shear stress and atherosclerosis (hsa05418)
  Glutathione metabolism (hsa00480)
  Hepatocellular carcinoma (hsa05225)
  Metabolic pathways (hsa01100)
  Metabolism of xenobiotics by cytochrome P450 (hsa00980)
  Pathways in cancer (hsa05200)
  Platinum drug resistance (hsa01524)
• Reactome Pathway:
  Glutathione conjugation (R-HSA-156590)
  Neutrophil degranulation (R-HSA-6798695)
  Aflatoxin activation and detoxification (R-HSA-5423646)

Molecular Interaction Atlas (MIA) of This DME

1 Approved Drug(s) Metabolized by This DME

Drug Name	Drug ID	Indication	ICD 11	Highest Status	REF
Glyceryl trinitrate	DMF72W3	N. A.	N. A.	Phase 4	[1]

Molecular Expression Atlas (MEA) of This DME

Disease Name	ICD 11	Studied Tissue	p-value	Fold-Change	Z-score
Acute myelocytic leukaemia	2B33.1	Bone marrow	1.24E-06	8.75E-01	1.09E+00
Alzheimer's disease	8A20	Entorhinal cortex	9.59E-04	4.24E-01	4.01E-01
Asthma	CA23	Nasal and bronchial airway	1.25E-01	8.59E-02	6.78E-02
Behcet's disease	4A62	Peripheral blood	1.52E-01	3.41E-01	8.84E-01
Bipolar disorder	6A60-6A6Z	Prefrontal cortex	1.59E-01	1.53E-01	2.83E-01
Bladder cancer	2C94	Bladder tissue	5.09E-08	-1.22E+00	-3.35E+00
Breast cancer	2C60-2C6Z	Breast tissue	1.21E-06	-8.21E-02	-6.49E-02
Colon cancer	2B90	Colon tissue	1.20E-51	-8.35E-01	-1.49E+00
Diffuse large B-cell lymphoma	2A81	Tonsil tissue	6.98E-01	-1.31E-02	-1.41E-01
Familial hypercholesterolemia	5C80.00	Peripheral blood	3.66E-01	-3.78E-02	-5.74E-02
Gastric cancer	2B72	Gastric tissue	8.37E-01	-2.10E-01	-9.80E-02
Glioblastopma	2A00.00	Nervous tissue	2.25E-17	7.74E-01	6.40E-01
Head and neck cancer	2D42	Head and neck tissue	5.07E-12	-2.36E+00	-1.29E+00
HIV-associated neurocognitive impairment	8A2Y-8A2Z	White matter tissue	2.89E-01	6.60E-01	7.17E-01
Idiopathic pulmonary fibrosis	CB03.4	Lung tissue	1.57E-05	-1.15E+00	-4.69E+00
Interstitial cystitis	GC00.3	Bladder tissue	3.09E-05	-1.75E+00	-5.21E+00
Ischemic stroke	8B11	Peripheral blood	8.83E-01	3.76E-02	5.80E-02
Liver cancer	2C12.0	Liver tissue	2.94E-03	-7.93E-01	-6.70E-01
Liver failure	DB99.7-DB99.8	Liver tissue	1.56E-02	-2.23E+00	-4.67E+00
Lung cancer	2C25	Lung tissue	5.46E-05	3.83E-02	5.15E-02
Lupus erythematosus	4A40	Whole blood	3.51E-10	7.14E-01	6.51E-01
Major depressive disorder	6A70-6A7Z	Hippocampus	6.60E-02	-1.51E-01	-2.76E-01
Multiple myeloma	2A83.1	Bone marrow	2.28E-02	1.87E-02	1.03E-01
Multiple myeloma	2A83.1	Peripheral blood	9.70E-01	-3.48E-02	-3.56E-02
Multiple sclerosis	8A40	Plasmacytoid dendritic cells	3.80E-01	-5.15E-01	-6.21E-01
Myelodysplastic syndrome	2A36-2A3Z	Bone marrow	6.48E-03	4.81E-01	5.36E-01
Myocardial infarction	BA41-BA50	Peripheral blood	1.90E-02	9.31E-01	5.61E-01
Neuroectodermal tumour	2A00.11	Brain stem tissue	5.15E-03	-8.39E-01	-1.16E+00
Non-alcoholic fatty liver disease	DB92	Liver tissue	1.63E-01	1.84E-01	3.85E-01
Obesity related type 2 diabetes	5A11	Omental adipose tissue	1.27E-01	-2.40E-01	-1.25E+00
Olive pollen allergy	CA08.00	Peripheral blood	2.25E-01	3.34E-01	5.31E-01
Oral cancer	2B6E	Oral tissue	9.85E-01	-2.99E-01	-2.43E-01
Ovarian cancer	2C73	Ovarian tissue	2.31E-02	2.42E+00	1.39E+00
Pancreatic cancer	2C10	Pancreas	9.50E-02	1.53E+00	8.47E-01
Parkinson's disease	8A00.0	Substantia nigra tissue	3.14E-01	1.41E-01	1.45E-01
Pituitary cancer	2D12	Pituitary tissue	1.57E-03	-1.10E+00	-1.04E+00
Polycystic ovary syndrome	5A80.1	Vastus lateralis muscle	2.24E-01	7.45E-02	1.31E-01
Pompe disease	5C51.3	Biceps muscle	1.82E-02	-5.66E-01	-7.41E-01
Prostate cancer	2C82	Prostate	8.95E-04	-6.12E-01	-6.37E-01
Psoriasis	EA90	Skin	1.38E-20	-1.61E+00	-1.59E+00
Rectal cancer	2B92	Rectal colon tissue	3.61E-04	-6.44E-01	-2.07E+00
Renal cancer	2C90-2C91	Kidney	9.79E-02	8.81E-01	5.54E-01
Retinoblastoma	2D02.2	Uvea	7.61E-04	3.12E+00	1.09E+01
Schizophrenia	6A20	Prefrontal cortex	3.15E-03	3.62E-01	4.83E-01
Schizophrenia	6A20	Superior temporal cortex	2.10E-01	4.09E-01	4.17E-01
Scleroderma	4A42.Z	Whole blood	1.07E-01	1.65E-01	5.27E-01
Seizure	8A60-8A6Z	Whole blood	8.89E-01	-1.63E-01	-2.07E-01
Sepsis with septic shock	1G41	Whole blood	2.65E-99	2.15E+00	3.24E+00
Sickle cell disease	3A51.0-3A51.3	Peripheral blood	5.16E-01	-5.86E-02	-4.43E-01
Simpson golabi behmel syndrome	LD2C	Adipose tissue	1.57E-01	-3.73E-02	-5.27E-01
Sjogren's syndrome	4A43.2	Salivary gland tissue	6.52E-04	-1.48E+00	-6.53E+00
Skin cancer	2C30-2C3Z	Skin	6.19E-95	-3.52E+00	-2.99E+00
Thrombocythemia	3B63	Whole blood	6.34E-02	1.45E-01	4.56E-01
Thrombocytopenia	3B64	Whole blood	4.13E-01	3.99E+00	1.52E+00
Thyroid cancer	2D10	Thyroid	2.31E-02	2.70E-01	4.62E-01
Tibial muscular dystrophy	8C75	Muscle tissue	7.82E-01	1.72E-01	1.25E-01
Tuberous sclerosis complex	LD2D.2	Perituberal tissue	1.84E-01	4.82E-01	1.72E+00
Type 2 diabetes	5A11	Liver tissue	9.42E-01	2.73E-01	4.35E-01
Ureter cancer	2C92	Urothelium	5.68E-02	1.42E-01	6.19E-01
Uterine cancer	2C78	Endometrium tissue	1.09E-09	-1.48E+00	-9.49E-01
Vitiligo	ED63.0	Skin	6.78E-01	-2.99E-01	-2.98E-01

References

• [1] Microsomal glutathione transferase 1: mechanism and functional roles. Drug Metab Rev. 2011 May;43(2):300-6.