Details of Drug-Metabolizing Enzyme (DME)

General Information of Drug-Metabolizing Enzyme (DME) (ID: DEB4JZV)

DME Name Gamma-glutamylcyclotransferase 2 (CHAC2)
Synonyms Glutathione-specific gamma-glutamylcyclotransferase 2; Cation transport regulator-like protein 2; Gamma-GCG 2; CHAC2
Gene Name CHAC2
UniProt ID
CHAC2_HUMAN
INTEDE ID
DME0450
3D Structure
Download
2D Sequence (FASTA)
Download
3D Structure (PDB)
Download
Gene ID
494143
EC Number EC: 4.3.2.7
Lyases
Carbon-nitrogen lyase
Amidine-lyase
EC: 4.3.2.7
Lineage Species: Homo sapiens
Kingdom: Metazoa
Phylum: Chordata
Class: Mammalia
Order: Primates
Family: Hominidae
Genus: Homo
Species: Homo sapiens
Sequence
MWVFGYGSLIWKVDFPYQDKLVGYITNYSRRFWQGSTDHRGVPGKPGRVVTLVEDPAGCV
WGVAYRLPVGKEEEVKAYLDFREKGGYRTTTVIFYPKDPTTKPFSVLLYIGTCDNPDYLG
PAPLEDIAEQIFNAAGPSGRNTEYLFELANSIRNLVPEEADEHLFALEKLVKERLEGKQN
LNCI
Function This enzyme catalyzes the cleavage of glutathione into 5-oxo-L-proline and a Cys-Gly dipeptide and acts specifically on glutathione, but not on other gamma-glutamyl peptides.
KEGG Pathway
Glutathione metabolism (hsa00480 )
Metabolic pathways (hsa01100 )
Reactome Pathway
Glutathione synthesis and recycling (R-HSA-174403 )

Molecular Interaction Atlas (MIA) of This DME

Molecular Interaction Atlas (MIA) Jump to Detail Molecular Interaction Atlas of This DME
1 Approved Drug(s) Metabolized by This DME
Drug Name Drug ID Indication ICD 11 Highest Status REF
Glutathione DMAHMT9 Human immunodeficiency virus infection 1C62 Approved [1]
Experimental Enzyme Kinetic Data of Drugs
Drug Name Indication Highest Status Kinetic Data REF
Glutathione Human immunodeficiency virus infection [1C62] Approved Km = 3.7 microM [1]

Molecular Expression Atlas (MEA) of This DME

Molecular Expression Atlas (MEA) Jump to Detail Molecular Expression Atlas of This DME
Disease Name ICD 11 Studied Tissue p-value Fold-Change Z-score
Acute myelocytic leukaemia 2B33.1 Bone marrow 3.02E-28 -1.53E+00 -1.44E+00
Alopecia ED70 Skin from scalp 4.48E-01 -6.49E-02 -1.50E-01
Alzheimer's disease 8A20 Entorhinal cortex 1.41E-03 -7.81E-02 -2.35E-01
Ankylosing spondylitis FA92.0 Pheripheral blood 8.99E-01 -5.57E-03 -1.98E-02
Aortic stenosis BB70 Calcified aortic valve 4.09E-01 -1.24E-01 -5.46E-01
Apnea 7A40 Hyperplastic tonsil 4.30E-01 -8.00E-02 -9.58E-02
Arthropathy FA00-FA5Z Peripheral blood 3.59E-01 -3.37E-02 -1.11E-01
Asthma CA23 Nasal and bronchial airway 8.13E-06 4.97E-01 4.49E-01
Atopic dermatitis EA80 Skin 7.99E-04 3.58E-01 9.97E-01
Autism 6A02 Whole blood 9.08E-01 -2.50E-02 -3.44E-02
Autoimmune uveitis 9A96 Peripheral monocyte 3.58E-01 3.00E-02 2.68E-01
Autosomal dominant monocytopenia 4B04 Whole blood 2.49E-05 -1.91E+00 -3.33E+00
Bacterial infection of gingival 1C1H Gingival tissue 3.59E-03 1.46E-01 3.30E-01
Batten disease 5C56.1 Whole blood 1.02E-01 -4.18E-01 -9.48E-01
Behcet's disease 4A62 Peripheral blood 3.33E-01 9.51E-02 2.28E-01
Bipolar disorder 6A60-6A6Z Prefrontal cortex 1.85E-01 -1.59E-01 -5.06E-01
Bladder cancer 2C94 Bladder tissue 1.10E-08 1.34E+00 4.64E+00
Breast cancer 2C60-2C6Z Breast tissue 8.37E-33 6.86E-01 8.86E-01
Cardioembolic stroke 8B11.20 Whole blood 6.65E-02 1.13E-01 2.39E-01
Cervical cancer 2C77 Cervical tissue 1.03E-01 2.16E-01 3.07E-01
Childhood onset rheumatic disease FA20.Z Peripheral blood 3.68E-01 1.63E-01 3.05E-01
Chronic hepatitis C 1E51.1 Whole blood 5.42E-01 4.77E-02 1.72E-01
Chronic obstructive pulmonary disease CA22 Lung tissue 4.53E-01 5.59E-02 1.47E-01
Chronic obstructive pulmonary disease CA22 Small airway epithelium 8.91E-01 -2.54E-02 -7.56E-02
Chronic rhinosinusitis CA0A Sinus mucosa tissue 1.11E-02 3.92E-01 1.72E+00
Colon cancer 2B90 Colon tissue 9.86E-01 4.30E-02 6.66E-02
Coronary artery disease BA80-BA8Z Peripheral blood 1.81E-01 4.60E-02 2.21E-01
Diffuse large B-cell lymphoma 2A81 Tonsil tissue 8.23E-01 -8.16E-02 -1.33E-01
Endometriosis GA10 Endometrium tissue 7.57E-02 -2.22E-01 -3.86E-01
Familial hypercholesterolemia 5C80.00 Peripheral blood 8.19E-02 3.26E-01 8.78E-01
Familial hypercholesterolemia 5C80.00 Whole blood 2.32E-02 -1.72E-01 -4.81E-01
Gastric cancer 2B72 Gastric tissue 4.11E-01 6.52E-01 3.93E-01
Glioblastopma 2A00.00 Nervous tissue 8.15E-104 9.40E-01 1.62E+00
Glioma 2A00.0Y-2A00.0Z Brain stem tissue 5.04E-01 -1.19E+00 -6.63E-01
Glioma 2A00.0Y-2A00.0Z White matter tissue 1.59E-02 1.15E+00 1.13E+00
Head and neck cancer 2D42 Head and neck tissue 7.43E-09 6.99E-01 7.62E-01
HIV-associated neurocognitive impairment 8A2Y-8A2Z White matter tissue 5.34E-02 -1.76E-01 -3.59E-01
Huntington's disease 8A01.10 Whole blood 3.16E-02 -1.34E-01 -9.48E-01
Idiopathic pulmonary fibrosis CB03.4 Lung tissue 1.19E-01 -4.43E-01 -7.72E-01
Immunodeficiency 4A00-4A20 Peripheral blood 2.55E-04 4.41E-01 1.95E+00
Influenza 1E30 Whole blood 2.93E-01 -3.61E-01 -6.52E-01
Interstitial cystitis GC00.3 Bladder tissue 9.26E-05 1.58E+00 4.05E+00
Intracranial aneurysm 8B01.0 Intracranial artery 9.05E-01 -1.65E-01 -3.04E-01
Irritable bowel syndrome DD91.0 Rectal colon tissue 9.82E-01 1.55E-01 2.25E-01
Ischemic stroke 8B11 Peripheral blood 1.26E-01 -2.79E-01 -4.52E-01
Juvenile idiopathic arthritis FA24 Peripheral blood 5.07E-01 -1.37E-01 -2.72E-01
Lateral sclerosis 8B60.4 Skin 6.42E-02 9.06E-01 1.28E+00
Lateral sclerosis 8B60.4 Cervical spinal cord 4.70E-01 -1.61E-01 -2.13E-01
Liver cancer 2C12.0 Liver tissue 8.05E-01 -2.22E-01 -4.21E-01
Liver failure DB99.7-DB99.8 Liver tissue 9.13E-01 5.38E-03 1.89E-02
Lung cancer 2C25 Lung tissue 1.12E-62 9.90E-01 1.77E+00
Lupus erythematosus 4A40 Whole blood 4.37E-03 1.31E-01 2.60E-01
Major depressive disorder 6A70-6A7Z Hippocampus 4.80E-01 -2.90E-02 -1.09E-01
Major depressive disorder 6A70-6A7Z Whole blood 1.56E-03 -2.89E-01 -5.10E-01
Melanoma 2C30 Skin 3.65E-02 4.46E-01 4.41E-01
Multiple myeloma 2A83.1 Peripheral blood 3.61E-01 -6.10E-01 -3.81E-01
Multiple myeloma 2A83.1 Bone marrow 1.12E-06 1.34E+00 4.94E+00
Multiple sclerosis 8A40 Plasmacytoid dendritic cells 1.32E-01 -2.44E-01 -7.59E-01
Myelodysplastic syndrome 2A36-2A3Z Bone marrow 1.20E-02 3.37E-01 4.97E-01
Myelofibrosis 2A20.2 Whole blood 9.13E-02 1.27E+00 3.11E+00
Myocardial infarction BA41-BA50 Peripheral blood 4.10E-01 -1.84E-02 -1.69E-02
Myopathy 8C70.6 Muscle tissue 5.78E-01 1.60E-01 4.64E-01
Neonatal sepsis KA60 Whole blood 7.65E-02 -2.50E-01 -3.01E-01
Neuroectodermal tumour 2A00.11 Brain stem tissue 1.31E-08 2.48E+00 4.92E+00
Non-alcoholic fatty liver disease DB92 Liver tissue 6.61E-01 -1.91E-02 -5.25E-02
Obesity related type 2 diabetes 5A11 Omental adipose tissue 5.00E-01 -1.31E-01 -1.53E-01
Olive pollen allergy CA08.00 Peripheral blood 1.34E-01 -3.91E-01 -8.09E-01
Oral cancer 2B6E Oral tissue 4.07E-06 1.04E+00 1.05E+00
Osteoarthritis FA00-FA0Z Synovial tissue 7.99E-01 3.20E-01 3.37E-01
Osteoporosis FB83.1 Bone marrow 5.37E-02 -1.06E+00 -8.47E-01
Ovarian cancer 2C73 Ovarian tissue 5.59E-06 2.09E+00 3.57E+00
Pancreatic cancer 2C10 Pancreas 9.28E-01 -2.49E-01 -4.47E-01
Parkinson's disease 8A00.0 Substantia nigra tissue 4.91E-01 -1.08E-01 -1.46E-01
Pediatric respiratory syncytial virus infection CA40.11 Peripheral blood 1.03E-01 2.25E-01 6.07E-01
Pituitary cancer 2D12 Pituitary tissue 2.13E-01 4.13E-02 6.85E-02
Pituitary gonadotrope tumour 2D12 Pituitary tissue 2.40E-01 1.33E-01 2.36E-01
Polycystic ovary syndrome 5A80.1 Vastus lateralis muscle 9.95E-01 -6.51E-02 -1.67E-01
Polycythemia vera 2A20.4 Whole blood 8.89E-01 4.68E-02 1.10E-01
Pompe disease 5C51.3 Biceps muscle 1.84E-02 3.44E-01 2.53E+00
Preterm birth KA21.4Z Myometrium 4.05E-01 -7.69E-02 -3.44E-01
Prostate cancer 2C82 Prostate 8.45E-01 -2.28E-01 -2.53E-01
Psoriasis EA90 Skin 7.08E-21 6.91E-01 1.40E+00
Rectal cancer 2B92 Rectal colon tissue 5.80E-01 -7.06E-02 -1.04E-01
Renal cancer 2C90-2C91 Kidney 1.31E-01 3.08E-01 6.33E-01
Retinoblastoma 2D02.2 Uvea 1.98E-05 -8.40E-01 -1.46E+00
Rheumatoid arthritis FA20 Synovial tissue 9.10E-01 1.30E-02 1.65E-02
Rhinovirus infection CA42.1 Nasal epithelium tissue 5.24E-01 4.51E-02 1.62E-01
Schizophrenia 6A20 Prefrontal cortex 9.39E-01 -7.03E-02 -9.83E-02
Schizophrenia 6A20 Superior temporal cortex 6.05E-01 -5.12E-02 -2.89E-01
Scleroderma 4A42.Z Whole blood 7.81E-01 2.14E-02 6.90E-02
Seizure 8A60-8A6Z Whole blood 6.14E-02 5.94E-01 7.47E-01
Sensitive skin EK0Z Skin 3.33E-01 1.46E-01 5.04E-01
Sepsis with septic shock 1G41 Whole blood 1.43E-02 -3.22E-01 -4.02E-01
Shwachman-Diamond syndrome 3A70.0 Bone marrow 5.75E-02 6.87E-01 1.04E+00
Sickle cell disease 3A51.0-3A51.3 Peripheral blood 5.12E-01 -1.14E-01 -7.26E-01
Simpson golabi behmel syndrome LD2C Adipose tissue 1.24E-01 -7.22E-01 -1.17E+00
Sjogren's syndrome 4A43.2 Salivary gland tissue 9.61E-01 1.90E-01 2.98E-01
Skin cancer 2C30-2C3Z Skin 6.44E-42 8.35E-01 1.60E+00
Thrombocythemia 3B63 Whole blood 4.74E-01 -6.54E-02 -1.59E-01
Thrombocytopenia 3B64 Whole blood 7.31E-01 1.72E-01 1.27E-01
Thyroid cancer 2D10 Thyroid 7.39E-03 3.65E-01 5.04E-01
Tibial muscular dystrophy 8C75 Muscle tissue 1.77E-02 -1.83E-01 -5.75E-01
Tuberous sclerosis complex LD2D.2 Perituberal tissue 2.80E-02 -5.65E-01 -2.96E+00
Type 2 diabetes 5A11 Liver tissue 1.29E-01 2.15E-01 7.52E-01
Ureter cancer 2C92 Urothelium 6.17E-01 -3.79E-02 -4.70E-01
Uterine cancer 2C78 Endometrium tissue 1.50E-17 1.18E+00 1.22E+00
Vitiligo ED63.0 Skin 6.71E-01 -2.50E-02 -1.18E-01
------------------------------------------------------------------------------------
⏷ Show the Full List of DME Expression Under 107 Diseases

References

1 ChaC2, an enzyme for slow turnover of cytosolic glutathione. J Biol Chem. 2017 Jan 13;292(2):638-651.