Details of Drug-Metabolizing Enzyme (DME)

General Information of Drug-Metabolizing Enzyme (DME) (ID: DEBJ2NL)

DME Name Inositol polyphosphate 4-phosphatase I (INPP4A)
Synonyms Inositol polyphosphate 4-phosphatase type I; Inositol polyphosphate-4-phosphatase type I A; Type I inositol 3,4-bisphosphate 4-phosphatase; INPP4A
Gene Name INPP4A
UniProt ID
INP4A_HUMAN
INTEDE ID
DME0525
3D Structure
Download
2D Sequence (FASTA)
Download
3D Structure (PDB)
Download
Gene ID
3631
EC Number EC: 3.1.3.66
Hydrolases
Ester bond hydrolase
Phosphoric monoester hydrolase
EC: 3.1.3.66
Lineage Species: Homo sapiens
Kingdom: Metazoa
Phylum: Chordata
Class: Mammalia
Order: Primates
Family: Hominidae
Genus: Homo
Species: Homo sapiens
Sequence
MTAREHSPRHGARARAMQRASTIDVAADMLGLSLAGNIQDPDEPILEFSLACSELHTPSL
DRKPNSFVAVSVTTPPQAFWTKHAQTEIIEGTNNPIFLSSIAFFQDSLINQMTQVKLSVY
DVKDRSQGTMYLLGSGTFIVKDLLQDRHHRLHLTLRSAESDRVGNITVIGWQMEEKSDQR
PPVTRSVDTVNGRMVLPVDESLTEALGIRSKYASLRKDTLLKSVFGGAICRMYRFPTTDG
NHLRILEQMAESVLSLHVPRQFVKLLLEEDAARVCELEELGELSPCWESLRRQIVTQYQT
IILTYQENLTDLHQYRGPSFKASSLKADKKLEFVPTNLHIQRMRVQDDGGSDQNYDIVTI
GAPAAHCQGFKSGGLRKKLHKFEETKKHFEECCTSSGCQSIIYIPQDVVRAKEIIAQINT
LKTQVSYYAERLSRAAKDRSATGLERTLAILADKTRQLVTVCDCKLLANSIHGLNAARPD
YIASKASPTSTEEEQVMLRNDQDTLMARWTGRNSRSSLQVDWHEEEWEKVWLNVDKSLEC
IIQRVDKLLQKERLHGEGCEDVFPCAGSCTSKKGNPDSHAYWIRPEDPFCDVPSSPCPST
MPSTACHPHLTTHCSPPPEESSPGEWSEALYPLLTTLTDCVAMMSDKAKKAMVFLLMQDS
APTIATYLSLQYRRDVVFCQTLTALICGFIIKLRNCLHDDGFLRQLYTIGLLAQFESLLS
TYGEELAMLEDMSLGIMDLRNVTFKVTQATSSASADMLPVITGNRDGFNVRVPLPGPLFD
ALPREIQSGMLLRVQPVLFNVGINEQQTLAERFGDTSLQEVINVESLVRLNSYFEQFKEV
LPEDCLPRSRSQTCLPELLRFLGQNVHARKNKNVDILWQAAEICRRLNGVRFTSCKSAKD
RTAMSVTLEQCLILQHEHGMAPQVFTQALECMRSEGCRRENTMKNVGSRKYAFNSLQLKA
FPKHYRPPEGTYGKVET
Function This enzyme catalyzes the hydrolysis of the 4-position phosphate of phosphatidylinositol 3,4-bisphosphate (PtdIns(3,4)P2). It also catalyzes inositol 1,3,4-trisphosphate and inositol 1,4-bisphosphate.
KEGG Pathway
Inositol phosphate metabolism (hsa00562 )
Metabolic pathways (hsa01100 )
Phosphatidylinositol signaling system (hsa04070 )
Reactome Pathway
Synthesis of PIPs at the early endosome membrane (R-HSA-1660516 )
Synthesis of PIPs at the plasma membrane (R-HSA-1660499 )
Synthesis of IP2, IP, and Ins in the cytosol (R-HSA-1855183 )

Molecular Interaction Atlas (MIA) of This DME

Molecular Interaction Atlas (MIA) Jump to Detail Molecular Interaction Atlas of This DME
2 Investigative Drug(s) Metabolized by This DME
Drug Name Drug ID Indication ICD 11 Highest Status REF
DMI-bisphosphate DMOJ92D N. A. N. A. Investigative [1]
DMI-trisphosphate DM3GYFZ N. A. N. A. Investigative [1]

Molecular Expression Atlas (MEA) of This DME

Molecular Expression Atlas (MEA) Jump to Detail Molecular Expression Atlas of This DME
Disease Name ICD 11 Studied Tissue p-value Fold-Change Z-score
Acute myelocytic leukaemia 2B33.1 Bone marrow 3.34E-14 -4.06E-01 -1.06E+00
Alopecia ED70 Skin from scalp 1.90E-01 3.71E-02 1.13E-01
Alzheimer's disease 8A20 Entorhinal cortex 2.78E-07 -4.25E-01 -6.82E-01
Ankylosing spondylitis FA92.0 Pheripheral blood 3.28E-01 1.58E-01 7.45E-01
Aortic stenosis BB70 Calcified aortic valve 9.22E-01 4.30E-02 2.85E-01
Apnea 7A40 Hyperplastic tonsil 2.61E-01 1.64E-01 7.74E-01
Arthropathy FA00-FA5Z Peripheral blood 6.01E-02 -1.52E-01 -1.06E+00
Asthma CA23 Nasal and bronchial airway 2.30E-01 8.03E-02 1.42E-01
Atopic dermatitis EA80 Skin 3.64E-02 -3.87E-02 -3.69E-01
Autism 6A02 Whole blood 8.48E-01 -2.19E-02 -5.22E-02
Autoimmune uveitis 9A96 Peripheral monocyte 9.98E-01 2.99E-02 1.74E-01
Autosomal dominant monocytopenia 4B04 Whole blood 1.62E-02 -9.24E-01 -2.18E+00
Bacterial infection of gingival 1C1H Gingival tissue 9.29E-18 3.59E-01 1.57E+00
Batten disease 5C56.1 Whole blood 5.68E-01 -9.63E-02 -3.28E-01
Behcet's disease 4A62 Peripheral blood 7.42E-01 -1.04E-01 -4.63E-01
Bipolar disorder 6A60-6A6Z Prefrontal cortex 3.59E-01 4.84E-02 1.74E-01
Bladder cancer 2C94 Bladder tissue 3.64E-07 -7.30E-01 -4.43E+00
Breast cancer 2C60-2C6Z Breast tissue 2.69E-34 2.22E-01 9.81E-01
Cardioembolic stroke 8B11.20 Whole blood 1.96E-01 4.89E-02 2.63E-01
Cervical cancer 2C77 Cervical tissue 1.71E-02 1.06E-01 6.60E-01
Childhood onset rheumatic disease FA20.Z Peripheral blood 9.36E-01 -4.63E-02 -1.86E-01
Chronic hepatitis C 1E51.1 Whole blood 1.66E-01 -2.89E-01 -6.95E-01
Chronic obstructive pulmonary disease CA22 Lung tissue 5.90E-03 1.37E-01 8.42E-01
Chronic obstructive pulmonary disease CA22 Small airway epithelium 5.11E-02 -1.02E-01 -5.10E-01
Chronic rhinosinusitis CA0A Sinus mucosa tissue 9.73E-01 -2.60E-02 -1.55E-01
Colon cancer 2B90 Colon tissue 7.23E-02 1.86E-02 8.36E-02
Coronary artery disease BA80-BA8Z Peripheral blood 5.77E-01 -1.11E-01 -3.06E-01
Diffuse large B-cell lymphoma 2A81 Tonsil tissue 5.05E-01 -8.47E-02 -1.43E-01
Endometriosis GA10 Endometrium tissue 2.98E-01 -1.46E-01 -5.48E-01
Familial hypercholesterolemia 5C80.00 Peripheral blood 4.70E-01 -3.44E-02 -1.72E-01
Familial hypercholesterolemia 5C80.00 Whole blood 8.14E-01 -7.54E-02 -3.59E-01
Gastric cancer 2B72 Gastric tissue 3.06E-01 7.49E-02 2.91E-01
Glioblastopma 2A00.00 Nervous tissue 2.58E-63 -7.31E-01 -1.02E+00
Glioma 2A00.0Y-2A00.0Z Brain stem tissue 5.65E-01 1.29E-01 6.95E-01
Glioma 2A00.0Y-2A00.0Z White matter tissue 1.05E-01 3.31E-01 6.05E-01
Head and neck cancer 2D42 Head and neck tissue 1.82E-13 3.20E-01 1.09E+00
HIV-associated neurocognitive impairment 8A2Y-8A2Z White matter tissue 2.44E-01 -2.30E-01 -5.21E-01
Huntington's disease 8A01.10 Whole blood 5.32E-01 -3.19E-02 -7.61E-02
Idiopathic pulmonary fibrosis CB03.4 Lung tissue 9.01E-01 2.48E-02 1.55E-01
Immunodeficiency 4A00-4A20 Peripheral blood 1.24E-02 -1.84E-01 -1.69E+00
Influenza 1E30 Whole blood 5.60E-01 7.23E-02 1.86E-01
Interstitial cystitis GC00.3 Bladder tissue 4.98E-02 -8.44E-02 -1.38E+00
Intracranial aneurysm 8B01.0 Intracranial artery 2.03E-01 1.95E-01 6.89E-01
Irritable bowel syndrome DD91.0 Rectal colon tissue 3.51E-01 9.58E-02 3.46E-01
Ischemic stroke 8B11 Peripheral blood 2.25E-01 -3.61E-02 -2.25E-01
Juvenile idiopathic arthritis FA24 Peripheral blood 4.16E-08 -1.94E-01 -7.02E-01
Lateral sclerosis 8B60.4 Skin 6.96E-02 2.65E-01 1.54E+00
Lateral sclerosis 8B60.4 Cervical spinal cord 3.66E-01 -5.73E-02 -1.95E-01
Liver cancer 2C12.0 Liver tissue 2.61E-13 2.66E-01 1.36E+00
Liver failure DB99.7-DB99.8 Liver tissue 5.31E-06 7.79E-01 4.29E+00
Lung cancer 2C25 Lung tissue 5.42E-31 1.94E-01 9.69E-01
Lupus erythematosus 4A40 Whole blood 5.21E-03 6.93E-01 7.35E-01
Major depressive disorder 6A70-6A7Z Hippocampus 4.63E-01 -4.31E-02 -1.60E-01
Major depressive disorder 6A70-6A7Z Whole blood 2.80E-01 2.76E-02 9.38E-02
Melanoma 2C30 Skin 2.31E-02 3.03E-02 5.44E-02
Multiple myeloma 2A83.1 Peripheral blood 8.04E-01 -4.37E-02 -1.69E-01
Multiple myeloma 2A83.1 Bone marrow 3.37E-02 1.76E-01 8.31E-01
Multiple sclerosis 8A40 Plasmacytoid dendritic cells 4.91E-01 1.91E-01 4.59E-01
Myelodysplastic syndrome 2A36-2A3Z Bone marrow 4.47E-01 -1.45E-02 -4.34E-02
Myelofibrosis 2A20.2 Whole blood 6.69E-04 -4.82E-01 -2.84E+00
Myocardial infarction BA41-BA50 Peripheral blood 4.60E-04 -1.14E+00 -1.22E+00
Myopathy 8C70.6 Muscle tissue 2.76E-02 2.60E-01 7.69E-01
Neonatal sepsis KA60 Whole blood 9.57E-03 -1.41E-01 -3.52E-01
Neuroectodermal tumour 2A00.11 Brain stem tissue 1.11E-05 -5.68E-01 -2.65E+00
Non-alcoholic fatty liver disease DB92 Liver tissue 2.57E-01 -5.08E-03 -3.92E-02
Obesity related type 2 diabetes 5A11 Omental adipose tissue 9.63E-01 7.54E-03 6.34E-02
Olive pollen allergy CA08.00 Peripheral blood 9.16E-01 -1.61E-01 -6.68E-01
Oral cancer 2B6E Oral tissue 2.50E-06 2.87E-01 9.46E-01
Osteoarthritis FA00-FA0Z Synovial tissue 1.61E-01 1.69E-01 5.53E-01
Osteoporosis FB83.1 Bone marrow 4.51E-01 2.92E-01 2.23E+00
Ovarian cancer 2C73 Ovarian tissue 6.25E-05 3.23E-01 1.99E+00
Pancreatic cancer 2C10 Pancreas 2.36E-02 5.22E-01 1.07E+00
Parkinson's disease 8A00.0 Substantia nigra tissue 5.77E-01 -5.07E-02 -1.68E-01
Pediatric respiratory syncytial virus infection CA40.11 Peripheral blood 1.96E-02 -2.48E-01 -1.14E+00
Pituitary cancer 2D12 Pituitary tissue 2.84E-02 2.15E-01 1.05E+00
Pituitary gonadotrope tumour 2D12 Pituitary tissue 4.79E-03 4.73E-01 2.58E+00
Polycystic ovary syndrome 5A80.1 Vastus lateralis muscle 1.44E-02 1.82E-01 1.72E+00
Polycythemia vera 2A20.4 Whole blood 1.04E-16 -5.00E-01 -2.54E+00
Pompe disease 5C51.3 Biceps muscle 3.04E-03 4.57E-01 1.95E+00
Preterm birth KA21.4Z Myometrium 1.15E-01 2.54E-01 7.47E-01
Prostate cancer 2C82 Prostate 2.36E-02 4.74E-01 8.78E-01
Psoriasis EA90 Skin 4.04E-13 1.11E-01 3.39E-01
Rectal cancer 2B92 Rectal colon tissue 6.86E-01 -2.81E-02 -1.78E-01
Renal cancer 2C90-2C91 Kidney 6.08E-03 4.34E-01 1.14E+00
Retinoblastoma 2D02.2 Uvea 1.36E-01 -2.89E-02 -1.11E-01
Rheumatoid arthritis FA20 Synovial tissue 1.29E-03 5.50E-01 2.51E+00
Rhinovirus infection CA42.1 Nasal epithelium tissue 6.10E-01 -1.62E-02 -1.41E-01
Schizophrenia 6A20 Prefrontal cortex 2.06E-01 -9.46E-02 -2.04E-01
Schizophrenia 6A20 Superior temporal cortex 7.05E-02 1.31E-01 4.65E-01
Scleroderma 4A42.Z Whole blood 6.16E-03 -1.27E-01 -1.05E+00
Seizure 8A60-8A6Z Whole blood 9.02E-01 -5.22E-02 -1.97E-01
Sensitive skin EK0Z Skin 2.94E-01 4.80E-02 6.90E-01
Sepsis with septic shock 1G41 Whole blood 3.12E-16 -3.27E-01 -9.84E-01
Shwachman-Diamond syndrome 3A70.0 Bone marrow 8.60E-01 -8.62E-02 -2.09E-01
Sickle cell disease 3A51.0-3A51.3 Peripheral blood 1.65E-01 -1.53E-01 -7.16E-01
Simpson golabi behmel syndrome LD2C Adipose tissue 7.29E-01 9.03E-02 5.28E-01
Sjogren's syndrome 4A43.2 Salivary gland tissue 6.15E-01 -1.96E-02 -6.00E-02
Skin cancer 2C30-2C3Z Skin 4.43E-32 4.35E-01 1.11E+00
Thrombocythemia 3B63 Whole blood 2.49E-10 -4.77E-01 -2.74E+00
Thrombocytopenia 3B64 Whole blood 5.63E-01 -3.29E-01 -4.35E-01
Thyroid cancer 2D10 Thyroid 1.32E-23 4.98E-01 1.59E+00
Tibial muscular dystrophy 8C75 Muscle tissue 9.24E-01 3.62E-03 1.74E-02
Tuberous sclerosis complex LD2D.2 Perituberal tissue 1.78E-02 -7.24E-01 -1.91E+00
Type 2 diabetes 5A11 Liver tissue 1.85E-01 -1.17E-01 -8.96E-01
Ureter cancer 2C92 Urothelium 3.42E-01 -8.90E-02 -6.09E-01
Uterine cancer 2C78 Endometrium tissue 4.09E-05 4.32E-02 1.46E-01
Vitiligo ED63.0 Skin 5.67E-01 9.74E-02 4.49E-01
------------------------------------------------------------------------------------
⏷ Show the Full List of DME Expression Under 107 Diseases

References

1 The cDNA cloning and characterization of inositol polyphosphate 4-phosphatase type II. Evidence for conserved alternative splicing in the 4-phosphatase family. J Biol Chem. 1997 Sep 19;272(38):23859-64.