Details of Drug-Metabolizing Enzyme (DME)

General Information of Drug-Metabolizing Enzyme (DME) (ID: DEBS17P)

DME Name Phosphoserine aminotransferase (PSAT1)
Synonyms Phosphohydroxythreonine aminotransferase; PSA; PSAT; PSAT1
Gene Name PSAT1
UniProt ID
SERC_HUMAN
INTEDE ID
DME0532
3D Structure
Download
2D Sequence (FASTA)
Download
3D Structure (PDB)
Download
Gene ID
29968
EC Number EC: 2.6.1.52
Transferase
Transaminase
Transaminase
EC: 2.6.1.52
Lineage Species: Homo sapiens
Kingdom: Metazoa
Phylum: Chordata
Class: Mammalia
Order: Primates
Family: Hominidae
Genus: Homo
Species: Homo sapiens
Sequence
MDAPRQVVNFGPGPAKLPHSVLLEIQKELLDYKGVGISVLEMSHRSSDFAKIINNTENLV
RELLAVPDNYKVIFLQGGGCGQFSAVPLNLIGLKAGRCADYVVTGAWSAKAAEEAKKFGT
INIVHPKLGSYTKIPDPSTWNLNPDASYVYYCANETVHGVEFDFIPDVKGAVLVCDMSSN
FLSKPVDVSKFGVIFAGAQKNVGSAGVTVVIVRDDLLGFALRECPSVLEYKVQAGNSSLY
NTPPCFSIYVMGLVLEWIKNNGGAAAMEKLSSIKSQTIYEIIDNSQGFYVCPVEPQNRSK
MNIPFRIGNAKGDDALEKRFLDKALELNMLSLKGHRSVGGIRASLYNAVTIEDVQKLAAF
MKKFLEMHQL
Function This enzyme catalyzes the reversible conversion of 3- phosphohydroxypyruvate to phosphoserine and of 3-hydroxy-2-oxo-4- phosphonooxybutanoate to phosphohydroxythreonine.
KEGG Pathway
Biosynthesis of amino acids (hsa01230 )
Carbon metabolism (hsa01200 )
Cysteine and methionine metabolism (hsa00270 )
Glycine, serine and threonine metabolism (hsa00260 )
Metabolic pathways (hsa01100 )
Vitamin B6 metabolism (hsa00750 )
Reactome Pathway
Serine biosynthesis (R-HSA-977347 )

Molecular Interaction Atlas (MIA) of This DME

Molecular Interaction Atlas (MIA) Jump to Detail Molecular Interaction Atlas of This DME
1 Investigative Drug(s) Metabolized by This DME
Drug Name Drug ID Indication ICD 11 Highest Status REF
Glyoxylate DMJ9XZO N. A. N. A. Investigative [1]

Molecular Expression Atlas (MEA) of This DME

Molecular Expression Atlas (MEA) Jump to Detail Molecular Expression Atlas of This DME
Disease Name ICD 11 Studied Tissue p-value Fold-Change Z-score
Acute myelocytic leukaemia 2B33.1 Bone marrow 2.65E-07 -4.00E-01 -7.82E-01
Alopecia ED70 Skin from scalp 6.49E-01 -7.19E-02 -1.80E-01
Alzheimer's disease 8A20 Entorhinal cortex 1.83E-06 3.07E-01 5.13E-01
Ankylosing spondylitis FA92.0 Pheripheral blood 7.16E-01 -1.36E-01 -1.95E-01
Aortic stenosis BB70 Calcified aortic valve 1.75E-01 -4.63E-01 -7.74E-01
Apnea 7A40 Hyperplastic tonsil 2.74E-01 -6.75E-01 -1.21E+00
Arthropathy FA00-FA5Z Peripheral blood 4.93E-01 -7.99E-02 -1.86E-01
Asthma CA23 Nasal and bronchial airway 2.71E-01 3.53E-02 5.11E-02
Atopic dermatitis EA80 Skin 1.56E-05 -8.83E-01 -1.93E+00
Autism 6A02 Whole blood 4.64E-05 -2.81E-01 -9.00E-01
Autoimmune uveitis 9A96 Peripheral monocyte 9.26E-01 7.07E-02 6.56E-01
Autosomal dominant monocytopenia 4B04 Whole blood 1.86E-01 3.36E-02 3.35E-01
Bacterial infection of gingival 1C1H Gingival tissue 4.07E-01 -3.54E-02 -9.66E-02
Batten disease 5C56.1 Whole blood 3.26E-01 8.54E-03 2.36E-02
Behcet's disease 4A62 Peripheral blood 9.21E-01 -1.51E-01 -4.63E-01
Bipolar disorder 6A60-6A6Z Prefrontal cortex 1.12E-01 1.05E-01 2.65E-01
Bladder cancer 2C94 Bladder tissue 8.00E-01 2.09E-02 4.51E-02
Breast cancer 2C60-2C6Z Breast tissue 3.51E-04 -6.36E-01 -1.21E+00
Cardioembolic stroke 8B11.20 Whole blood 1.90E-01 1.79E-01 4.63E-01
Cervical cancer 2C77 Cervical tissue 1.74E-01 -1.61E-02 -3.12E-02
Childhood onset rheumatic disease FA20.Z Peripheral blood 2.00E-01 1.85E-01 3.89E-01
Chronic hepatitis C 1E51.1 Whole blood 6.91E-01 5.33E-02 2.32E-01
Chronic obstructive pulmonary disease CA22 Lung tissue 4.84E-01 8.56E-02 2.34E-01
Chronic obstructive pulmonary disease CA22 Small airway epithelium 2.14E-03 -3.57E-01 -5.69E-01
Chronic rhinosinusitis CA0A Sinus mucosa tissue 9.28E-02 4.77E-01 1.42E+00
Colon cancer 2B90 Colon tissue 4.84E-150 2.70E+00 4.97E+00
Coronary artery disease BA80-BA8Z Peripheral blood 8.97E-01 -1.08E-01 -3.88E-01
Diffuse large B-cell lymphoma 2A81 Tonsil tissue 5.49E-01 2.77E-01 3.63E-01
Endometriosis GA10 Endometrium tissue 2.82E-02 -9.88E-01 -7.35E-01
Familial hypercholesterolemia 5C80.00 Peripheral blood 4.77E-01 -1.13E-01 -2.86E-01
Familial hypercholesterolemia 5C80.00 Whole blood 1.35E-07 -5.15E-01 -1.36E+00
Gastric cancer 2B72 Gastric tissue 4.37E-01 3.62E-01 4.30E-01
Glioblastopma 2A00.00 Nervous tissue 4.59E-01 1.29E-01 1.68E-01
Glioma 2A00.0Y-2A00.0Z Brain stem tissue 5.51E-01 5.29E-01 5.03E-01
Glioma 2A00.0Y-2A00.0Z White matter tissue 3.71E-01 -1.99E-01 -3.07E-01
Head and neck cancer 2D42 Head and neck tissue 3.98E-14 7.26E-01 8.33E-01
HIV-associated neurocognitive impairment 8A2Y-8A2Z White matter tissue 3.24E-01 5.95E-03 1.58E-02
Huntington's disease 8A01.10 Whole blood 1.19E-01 -9.57E-02 -4.38E-01
Idiopathic pulmonary fibrosis CB03.4 Lung tissue 1.24E-01 -1.13E+00 -8.66E-01
Immunodeficiency 4A00-4A20 Peripheral blood 1.07E-04 5.32E-01 2.35E+00
Influenza 1E30 Whole blood 4.59E-03 5.13E-01 5.93E+00
Interstitial cystitis GC00.3 Bladder tissue 4.01E-02 -4.87E-01 -1.01E+00
Intracranial aneurysm 8B01.0 Intracranial artery 2.59E-01 1.58E-01 3.03E-01
Irritable bowel syndrome DD91.0 Rectal colon tissue 1.22E-01 1.75E-01 3.66E-01
Ischemic stroke 8B11 Peripheral blood 5.65E-01 3.20E-02 7.44E-02
Juvenile idiopathic arthritis FA24 Peripheral blood 5.16E-02 6.38E-02 1.81E-01
Lateral sclerosis 8B60.4 Skin 7.10E-01 -1.48E-01 -2.07E-01
Lateral sclerosis 8B60.4 Cervical spinal cord 1.77E-01 2.77E-01 1.00E+00
Liver cancer 2C12.0 Liver tissue 1.09E-13 -1.48E+00 -1.73E+00
Liver failure DB99.7-DB99.8 Liver tissue 9.08E-03 -1.41E+00 -2.78E+00
Lung cancer 2C25 Lung tissue 1.81E-120 2.15E+00 3.34E+00
Lupus erythematosus 4A40 Whole blood 4.46E-06 2.07E-01 4.51E-01
Major depressive disorder 6A70-6A7Z Hippocampus 3.06E-01 -6.54E-02 -1.66E-01
Major depressive disorder 6A70-6A7Z Whole blood 1.51E-01 -4.69E-02 -1.54E-01
Melanoma 2C30 Skin 5.39E-01 2.80E-01 1.81E-01
Multiple myeloma 2A83.1 Peripheral blood 7.24E-01 -2.74E-01 -1.48E-01
Multiple myeloma 2A83.1 Bone marrow 2.75E-04 1.00E+00 2.62E+00
Multiple sclerosis 8A40 Plasmacytoid dendritic cells 4.27E-01 4.64E-02 2.15E-01
Myelodysplastic syndrome 2A36-2A3Z Bone marrow 1.55E-12 5.39E-01 1.86E+00
Myelofibrosis 2A20.2 Whole blood 5.07E-02 4.14E-01 1.95E+00
Myocardial infarction BA41-BA50 Peripheral blood 4.47E-02 -2.54E-01 -4.14E-01
Myopathy 8C70.6 Muscle tissue 5.27E-06 5.47E-01 3.31E+00
Neonatal sepsis KA60 Whole blood 2.64E-04 1.76E-01 4.59E-01
Neuroectodermal tumour 2A00.11 Brain stem tissue 3.79E-06 -7.96E-01 -1.70E+00
Non-alcoholic fatty liver disease DB92 Liver tissue 4.24E-01 1.96E-01 2.12E-01
Obesity related type 2 diabetes 5A11 Omental adipose tissue 2.98E-02 7.13E-01 1.78E+00
Olive pollen allergy CA08.00 Peripheral blood 1.81E-01 -5.25E-01 -1.12E+00
Oral cancer 2B6E Oral tissue 1.86E-02 3.14E-01 3.38E-01
Osteoarthritis FA00-FA0Z Synovial tissue 5.27E-01 8.33E-02 3.84E-02
Osteoporosis FB83.1 Bone marrow 4.26E-03 1.26E+00 2.53E+00
Ovarian cancer 2C73 Ovarian tissue 5.27E-05 2.93E+00 2.93E+00
Pancreatic cancer 2C10 Pancreas 1.32E-02 -1.49E+00 -1.12E+00
Parkinson's disease 8A00.0 Substantia nigra tissue 2.74E-01 2.89E-01 6.98E-01
Pediatric respiratory syncytial virus infection CA40.11 Peripheral blood 1.91E-04 7.39E-01 2.05E+00
Pituitary cancer 2D12 Pituitary tissue 8.85E-02 -6.78E-02 -1.23E-01
Pituitary gonadotrope tumour 2D12 Pituitary tissue 3.33E-01 -1.96E-01 -3.12E-01
Polycystic ovary syndrome 5A80.1 Vastus lateralis muscle 6.17E-01 5.53E-03 5.91E-02
Polycythemia vera 2A20.4 Whole blood 8.07E-01 -1.37E-02 -6.54E-02
Pompe disease 5C51.3 Biceps muscle 4.03E-03 6.69E-01 2.12E+00
Preterm birth KA21.4Z Myometrium 5.74E-02 -8.90E-01 -1.35E+00
Prostate cancer 2C82 Prostate 1.01E-01 7.39E-01 7.05E-01
Psoriasis EA90 Skin 7.29E-01 1.01E-01 1.78E-01
Rectal cancer 2B92 Rectal colon tissue 6.72E-05 1.69E+00 3.60E+00
Renal cancer 2C90-2C91 Kidney 7.29E-03 -1.87E+00 -1.41E+00
Retinoblastoma 2D02.2 Uvea 1.10E-03 1.04E+00 3.33E+00
Rheumatoid arthritis FA20 Synovial tissue 4.98E-06 8.27E-01 2.42E+00
Rhinovirus infection CA42.1 Nasal epithelium tissue 2.58E-01 1.80E-01 3.93E-01
Schizophrenia 6A20 Prefrontal cortex 2.05E-01 4.33E-02 3.29E-02
Schizophrenia 6A20 Superior temporal cortex 5.68E-01 -1.27E-02 -3.41E-02
Scleroderma 4A42.Z Whole blood 7.16E-02 -1.46E-01 -5.97E-01
Seizure 8A60-8A6Z Whole blood 6.78E-01 -4.97E-02 -8.86E-02
Sensitive skin EK0Z Skin 3.36E-01 1.75E-01 7.36E-01
Sepsis with septic shock 1G41 Whole blood 2.54E-15 2.30E-01 5.89E-01
Shwachman-Diamond syndrome 3A70.0 Bone marrow 6.82E-02 7.36E-01 1.82E+00
Sickle cell disease 3A51.0-3A51.3 Peripheral blood 1.06E-02 -2.63E-01 -1.37E+00
Simpson golabi behmel syndrome LD2C Adipose tissue 5.70E-01 5.22E-03 2.17E-02
Sjogren's syndrome 4A43.2 Salivary gland tissue 4.33E-01 -1.72E-01 -1.73E-01
Skin cancer 2C30-2C3Z Skin 3.83E-22 -9.93E-01 -1.20E+00
Thrombocythemia 3B63 Whole blood 6.35E-01 1.08E-01 4.89E-01
Thrombocytopenia 3B64 Whole blood 3.76E-01 -5.98E-01 -8.70E-01
Thyroid cancer 2D10 Thyroid 3.25E-04 -5.85E-01 -1.28E+00
Tibial muscular dystrophy 8C75 Muscle tissue 3.46E-08 7.31E-01 2.68E+00
Tuberous sclerosis complex LD2D.2 Perituberal tissue 4.73E-01 8.25E-02 2.54E-01
Type 2 diabetes 5A11 Liver tissue 2.23E-01 -2.01E-01 -1.97E+00
Ureter cancer 2C92 Urothelium 6.28E-02 6.48E-02 5.80E-01
Uterine cancer 2C78 Endometrium tissue 2.53E-02 3.00E-01 2.40E-01
Vitiligo ED63.0 Skin 1.46E-02 3.13E-01 1.14E+00
------------------------------------------------------------------------------------
⏷ Show the Full List of DME Expression Under 107 Diseases

References

1 Recombinant production of eight human cytosolic aminotransferases and assessment of their potential involvement in glyoxylate metabolism. Biochem J. 2009 Aug 13;422(2):265-72.