Details of Drug-Metabolizing Enzyme (DME)

General Information of Drug-Metabolizing Enzyme (DME) (ID: DECVGJ3)

DME Name Nicotinamide N-methyltransferase (NNMT)
Synonyms Nicotinamide-methyltransferase; Nicotinamide-methyl transferase; Methyl nicotinamide transferase; NNMT
Gene Name NNMT
UniProt ID
NNMT_HUMAN
INTEDE ID
DME0445
3D Structure
Download
2D Sequence (FASTA)
Download
3D Structure (PDB)
Download
Gene ID
4837
EC Number EC: 2.1.1.1
Transferase
Methylase
Methyltransferase
EC: 2.1.1.1
Lineage Species: Homo sapiens
Kingdom: Metazoa
Phylum: Chordata
Class: Mammalia
Order: Primates
Family: Hominidae
Genus: Homo
Species: Homo sapiens
Sequence
MESGFTSKDTYLSHFNPRDYLEKYYKFGSRHSAESQILKHLLKNLFKIFCLDGVKGDLLI
DIGSGPTIYQLLSACESFKEIVVTDYSDQNLQELEKWLKKEPEAFDWSPVVTYVCDLEGN
RVKGPEKEEKLRQAVKQVLKCDVTQSQPLGAVPLPPADCVLSTLCLDAACPDLPTYCRAL
RNLGSLLKPGGFLVIMDALKSSYYMIGEQKFSSLPLGREAVEAAVKEAGYTIEWFEVISQ
SYSSTMANNEGLFSLVARKLSRPL
Function This enzyme catalyzes the N-methylation of nicotinamide and other pyridines to form pyridinium ions. This activity is important for biotransformation of many drugs and xenobiotic compounds.
KEGG Pathway
Metabolic pathways (hsa01100 )
Nicotinate and nicotinamide metabolism (hsa00760 )
Reactome Pathway
Methylation (R-HSA-156581 )
Nicotinamide salvaging (R-HSA-197264 )
Metabolism of ingested SeMet, Sec, MeSec into H2Se (R-HSA-2408508 )

Molecular Interaction Atlas (MIA) of This DME

Molecular Interaction Atlas (MIA) Jump to Detail Molecular Interaction Atlas of This DME
1 Clinical Trial Drug(s) Metabolized by This DME
Drug Name Drug ID Indication ICD 11 Highest Status REF
ASP-015K DMZ1UOI Psoriasis vulgaris EA90 Phase 3 [1]

Molecular Expression Atlas (MEA) of This DME

Molecular Expression Atlas (MEA) Jump to Detail Molecular Expression Atlas of This DME
Disease Name ICD 11 Studied Tissue p-value Fold-Change Z-score
Acute myelocytic leukaemia 2B33.1 Bone marrow 1.47E-01 -1.68E-01 -2.29E-01
Alopecia ED70 Skin from scalp 2.60E-01 8.99E-02 1.96E-01
Alzheimer's disease 8A20 Entorhinal cortex 1.22E-01 -1.22E-01 -3.92E-01
Ankylosing spondylitis FA92.0 Pheripheral blood 2.15E-01 -1.53E-01 -1.04E+00
Aortic stenosis BB70 Calcified aortic valve 4.12E-01 5.35E-01 4.75E-01
Apnea 7A40 Hyperplastic tonsil 8.30E-01 7.76E-02 1.06E-01
Arthropathy FA00-FA5Z Peripheral blood 6.74E-01 -5.05E-02 -4.91E-01
Asthma CA23 Nasal and bronchial airway 1.89E-01 3.65E-03 7.47E-03
Atopic dermatitis EA80 Skin 4.57E-02 -3.57E-01 -7.02E-01
Autism 6A02 Whole blood 5.61E-03 -1.53E-01 -8.76E-01
Autoimmune uveitis 9A96 Peripheral monocyte 6.12E-04 -2.01E-01 -1.83E+00
Autosomal dominant monocytopenia 4B04 Whole blood 7.84E-01 -5.61E-02 -3.49E-01
Bacterial infection of gingival 1C1H Gingival tissue 9.85E-12 7.38E-01 9.24E-01
Batten disease 5C56.1 Whole blood 6.30E-02 1.27E-01 1.17E+00
Behcet's disease 4A62 Peripheral blood 4.62E-01 -1.94E-02 -7.23E-02
Bipolar disorder 6A60-6A6Z Prefrontal cortex 8.62E-02 -7.48E-02 -1.86E-01
Bladder cancer 2C94 Bladder tissue 5.30E-02 1.66E+00 1.20E+00
Breast cancer 2C60-2C6Z Breast tissue 1.00E-06 -1.01E-02 -1.14E-02
Cardioembolic stroke 8B11.20 Whole blood 4.12E-01 -9.32E-02 -3.94E-01
Cervical cancer 2C77 Cervical tissue 3.69E-04 1.60E+00 1.38E+00
Childhood onset rheumatic disease FA20.Z Peripheral blood 3.21E-01 -9.44E-03 -5.51E-02
Chronic hepatitis C 1E51.1 Whole blood 7.69E-01 -4.29E-02 -1.65E-01
Chronic obstructive pulmonary disease CA22 Lung tissue 7.97E-02 5.17E-01 4.95E-01
Chronic obstructive pulmonary disease CA22 Small airway epithelium 2.08E-01 5.56E-02 2.00E-01
Chronic rhinosinusitis CA0A Sinus mucosa tissue 9.03E-01 -2.38E-01 -1.69E-01
Colon cancer 2B90 Colon tissue 4.84E-51 1.69E+00 1.96E+00
Coronary artery disease BA80-BA8Z Peripheral blood 4.74E-01 -6.84E-02 -3.39E-01
Diffuse large B-cell lymphoma 2A81 Tonsil tissue 4.93E-01 -1.22E-01 -8.24E-01
Endometriosis GA10 Endometrium tissue 6.23E-07 2.78E+00 1.92E+00
Familial hypercholesterolemia 5C80.00 Peripheral blood 4.08E-01 -3.40E-02 -2.07E-01
Familial hypercholesterolemia 5C80.00 Whole blood 4.71E-06 -3.04E-01 -1.17E+00
Gastric cancer 2B72 Gastric tissue 8.00E-02 1.14E+00 1.36E+00
Glioblastopma 2A00.00 Nervous tissue 1.54E-89 1.10E+00 1.41E+00
Glioma 2A00.0Y-2A00.0Z Brain stem tissue 1.37E-02 2.03E+00 4.64E+00
Glioma 2A00.0Y-2A00.0Z White matter tissue 1.32E-01 2.19E-01 3.03E-01
Head and neck cancer 2D42 Head and neck tissue 1.18E-40 3.37E+00 2.25E+00
HIV-associated neurocognitive impairment 8A2Y-8A2Z White matter tissue 5.05E-01 1.25E-01 4.17E-01
Huntington's disease 8A01.10 Whole blood 7.74E-02 -1.27E-01 -1.28E+00
Idiopathic pulmonary fibrosis CB03.4 Lung tissue 4.69E-01 -3.04E-01 -7.83E-01
Immunodeficiency 4A00-4A20 Peripheral blood 6.88E-01 3.96E-02 4.34E-01
Influenza 1E30 Whole blood 6.23E-01 6.98E-02 3.28E-01
Interstitial cystitis GC00.3 Bladder tissue 1.91E-04 2.95E+00 3.64E+00
Intracranial aneurysm 8B01.0 Intracranial artery 1.29E-02 1.07E+00 1.24E+00
Irritable bowel syndrome DD91.0 Rectal colon tissue 8.33E-01 -3.79E-02 -1.14E-01
Ischemic stroke 8B11 Peripheral blood 7.76E-01 1.47E-02 7.17E-02
Juvenile idiopathic arthritis FA24 Peripheral blood 1.17E-02 7.88E-02 2.74E-01
Lateral sclerosis 8B60.4 Skin 4.87E-02 -6.74E-01 -1.44E+00
Lateral sclerosis 8B60.4 Cervical spinal cord 8.08E-01 2.23E-01 6.82E-01
Liver cancer 2C12.0 Liver tissue 1.29E-41 -3.05E+00 -4.02E+00
Liver failure DB99.7-DB99.8 Liver tissue 2.92E-04 -3.27E+00 -6.44E+00
Lung cancer 2C25 Lung tissue 3.21E-13 -5.88E-01 -6.64E-01
Lupus erythematosus 4A40 Whole blood 9.47E-04 9.58E-02 3.48E-01
Major depressive disorder 6A70-6A7Z Hippocampus 4.33E-01 -1.01E-01 -2.59E-01
Major depressive disorder 6A70-6A7Z Whole blood 2.22E-01 2.36E-02 1.00E-01
Melanoma 2C30 Skin 5.53E-01 3.28E-01 1.77E-01
Multiple myeloma 2A83.1 Peripheral blood 2.73E-02 -1.27E-01 -4.45E-01
Multiple myeloma 2A83.1 Bone marrow 1.75E-03 -4.71E-01 -1.97E+00
Multiple sclerosis 8A40 Plasmacytoid dendritic cells 4.94E-01 1.76E-01 5.36E-01
Myelodysplastic syndrome 2A36-2A3Z Bone marrow 2.54E-03 5.48E-01 6.12E-01
Myelofibrosis 2A20.2 Whole blood 2.02E-02 3.20E-01 2.17E+00
Myocardial infarction BA41-BA50 Peripheral blood 1.63E-05 5.33E-01 1.10E+00
Myopathy 8C70.6 Muscle tissue 2.49E-03 3.08E+00 1.98E+00
Neonatal sepsis KA60 Whole blood 9.52E-01 -7.49E-02 -2.84E-01
Neuroectodermal tumour 2A00.11 Brain stem tissue 1.89E-02 7.74E-02 1.19E-01
Non-alcoholic fatty liver disease DB92 Liver tissue 2.79E-01 1.00E+00 1.33E+00
Obesity related type 2 diabetes 5A11 Omental adipose tissue 7.21E-02 -4.07E-01 -1.00E+00
Olive pollen allergy CA08.00 Peripheral blood 5.70E-01 9.05E-02 3.77E-01
Oral cancer 2B6E Oral tissue 5.78E-06 1.84E+00 1.40E+00
Osteoarthritis FA00-FA0Z Synovial tissue 2.93E-01 3.50E-01 1.81E-01
Osteoporosis FB83.1 Bone marrow 8.32E-01 -3.20E-02 -4.76E-02
Ovarian cancer 2C73 Ovarian tissue 3.92E-02 2.54E+00 1.43E+00
Pancreatic cancer 2C10 Pancreas 5.07E-01 6.60E-01 6.74E-01
Parkinson's disease 8A00.0 Substantia nigra tissue 9.52E-01 -2.85E-01 -6.98E-01
Pediatric respiratory syncytial virus infection CA40.11 Peripheral blood 6.47E-01 1.31E-02 8.69E-02
Pituitary cancer 2D12 Pituitary tissue 2.08E-03 -2.48E+00 -1.28E+00
Pituitary gonadotrope tumour 2D12 Pituitary tissue 3.27E-06 -3.68E+00 -2.70E+00
Polycystic ovary syndrome 5A80.1 Vastus lateralis muscle 2.29E-01 -1.46E-01 -5.66E-01
Polycythemia vera 2A20.4 Whole blood 1.67E-16 4.00E-01 2.38E+00
Pompe disease 5C51.3 Biceps muscle 2.63E-06 1.97E+00 2.94E+00
Preterm birth KA21.4Z Myometrium 1.27E-01 -9.73E-01 -1.40E+00
Prostate cancer 2C82 Prostate 4.99E-01 -6.69E-01 -2.85E-01
Psoriasis EA90 Skin 6.89E-09 -5.63E-01 -7.51E-01
Rectal cancer 2B92 Rectal colon tissue 8.42E-02 4.95E-01 5.20E-01
Renal cancer 2C90-2C91 Kidney 5.69E-05 5.91E+00 2.75E+00
Retinoblastoma 2D02.2 Uvea 2.92E-06 2.15E+00 8.24E+00
Rheumatoid arthritis FA20 Synovial tissue 2.02E-04 3.10E+00 3.01E+00
Rhinovirus infection CA42.1 Nasal epithelium tissue 1.27E-02 7.50E-02 4.57E-01
Schizophrenia 6A20 Prefrontal cortex 1.46E-02 -4.23E-01 -5.26E-01
Schizophrenia 6A20 Superior temporal cortex 4.91E-01 9.99E-03 1.11E-01
Scleroderma 4A42.Z Whole blood 5.30E-06 2.29E-01 2.23E+00
Seizure 8A60-8A6Z Whole blood 7.30E-01 -4.75E-03 -2.29E-02
Sensitive skin EK0Z Skin 7.29E-01 6.87E-02 3.04E-01
Sepsis with septic shock 1G41 Whole blood 5.83E-02 -7.73E-03 -2.70E-02
Shwachman-Diamond syndrome 3A70.0 Bone marrow 3.45E-01 -2.19E-01 -4.43E-01
Sickle cell disease 3A51.0-3A51.3 Peripheral blood 4.53E-01 2.77E-01 7.23E-01
Simpson golabi behmel syndrome LD2C Adipose tissue 8.88E-01 1.25E-01 3.41E-01
Sjogren's syndrome 4A43.2 Salivary gland tissue 3.48E-01 -2.28E-01 -1.25E+00
Skin cancer 2C30-2C3Z Skin 8.51E-07 -4.94E-01 -5.72E-01
Thrombocythemia 3B63 Whole blood 6.91E-05 4.43E-01 2.70E+00
Thrombocytopenia 3B64 Whole blood 2.93E-01 1.41E+00 1.36E+00
Thyroid cancer 2D10 Thyroid 5.25E-04 2.25E-01 2.67E-01
Tibial muscular dystrophy 8C75 Muscle tissue 1.82E-04 2.51E+00 1.59E+00
Tuberous sclerosis complex LD2D.2 Perituberal tissue 2.28E-01 2.08E-01 1.02E+00
Type 2 diabetes 5A11 Liver tissue 4.47E-01 7.33E-01 5.79E-01
Ureter cancer 2C92 Urothelium 1.39E-01 -1.43E-01 -7.66E-01
Uterine cancer 2C78 Endometrium tissue 3.31E-02 1.02E+00 6.22E-01
Vitiligo ED63.0 Skin 4.99E-01 1.14E-01 1.84E-01
------------------------------------------------------------------------------------
⏷ Show the Full List of DME Expression Under 107 Diseases

References

1 Human mass balance, metabolite profile and identification of metabolic enzymes of [14C]ASP015K, a novel oral janus kinase inhibitor. Xenobiotica. 2015;45(10):887-902.