Details of Drug-Metabolizing Enzyme (DME)

General Information of Drug-Metabolizing Enzyme (DME) (ID: DECY3P8)

DME Name Carnosine N-methyltransferase (CARNMT1)
Synonyms S-adenosyl-L-methionine:carnosine N-methyltransferase; CARNMT1; C9orf41
Gene Name CARNMT1
UniProt ID
CARME_HUMAN
INTEDE ID
DME0488
3D Structure
Download
2D Sequence (FASTA)
Download
3D Structure (PDB)
Download
Gene ID
138199
EC Number EC: 2.1.1.22
Transferase
Methylase
Methyltransferase
EC: 2.1.1.22
Lineage Species: Homo sapiens
Kingdom: Metazoa
Phylum: Chordata
Class: Mammalia
Order: Primates
Family: Hominidae
Genus: Homo
Species: Homo sapiens
Sequence
MQRRRRPPPPTSRLPEGCGGGGGGSEEVEVQFSAGRWGSAAAVSAAAAAATRSTEEEEER
LEREHFWKIINAFRYYGTSMHERVNRTERQFRSLPANQQKLLPQFLLHLDKIRKCIDHNQ
EILLTIVNDCIHMFENKEYGEDGNGKIMPASTFDMDKLKSTLKQFVRDWSETGKAERDAC
YQPIIKEILKNFPKERWDPSKVNILVPGAGLGRLAWEIAMLGYACQGNEWSFFMLFSSNF
VLNRCSEINKYKLYPWIHQFSNNRRSADQIRPIFFPDVDPHSLPPGSNFSMTAGDFQEIY
SECNTWDCIATCFFIDTAHNVIDYIDTIWKILKPGGIWINLGPLLYHFENLANELSIELS
YEDIKNVVLQYGFKVEVEKESVLSTYTVNDLSMMKYYYECVLFVVRKPQ
Function
This enzyme catalyzes the formation of anserine (beta-alanyl-N(Pi)-methyl-L-histidine) from carnosine. Anserine, a methylated derivative of carnosine (beta-alanyl-L-histidine). It also methylates other L-histidine-containing di- and tripeptides such as Gly-Gly-His, Gly-His and homocarnosine (GABA-His).
KEGG Pathway
Histidine metabolism (hsa00340 )
Metabolic pathways (hsa01100 )
Reactome Pathway
Histidine catabolism (R-HSA-70921 )

Molecular Interaction Atlas (MIA) of This DME

Molecular Interaction Atlas (MIA) Jump to Detail Molecular Interaction Atlas of This DME
1 Investigative Drug(s) Metabolized by This DME
Drug Name Drug ID Indication ICD 11 Highest Status REF
carnosine DMFYCB4 Discovery agent N.A. Investigative [1]
Experimental Enzyme Kinetic Data of Drugs
Drug Name Indication Highest Status Kinetic Data REF
carnosine Discovery agent [N.A.] Investigative Km = 4.96 microM [1]

Molecular Expression Atlas (MEA) of This DME

Molecular Expression Atlas (MEA) Jump to Detail Molecular Expression Atlas of This DME
Disease Name ICD 11 Studied Tissue p-value Fold-Change Z-score
Acute myelocytic leukaemia 2B33.1 Bone marrow 1.07E-02 9.04E-02 2.53E-01
Alopecia ED70 Skin from scalp 8.59E-02 -1.27E-01 -6.85E-01
Alzheimer's disease 8A20 Entorhinal cortex 4.03E-08 -1.47E-01 -5.38E-01
Ankylosing spondylitis FA92.0 Pheripheral blood 8.77E-01 1.22E-01 4.04E-01
Aortic stenosis BB70 Calcified aortic valve 9.27E-02 -1.36E-01 -5.58E-01
Apnea 7A40 Hyperplastic tonsil 9.11E-01 8.11E-02 2.14E-01
Arthropathy FA00-FA5Z Peripheral blood 3.70E-02 -1.20E-01 -4.21E-01
Asthma CA23 Nasal and bronchial airway 3.38E-02 5.07E-01 7.85E-01
Atopic dermatitis EA80 Skin 9.06E-05 2.35E-01 1.42E+00
Autism 6A02 Whole blood 1.41E-01 4.99E-02 1.91E-01
Autoimmune uveitis 9A96 Peripheral monocyte 1.54E-01 2.56E-01 1.71E+00
Autosomal dominant monocytopenia 4B04 Whole blood 5.66E-01 -3.00E-01 -1.02E+00
Bacterial infection of gingival 1C1H Gingival tissue 4.52E-08 -2.26E-01 -8.08E-01
Batten disease 5C56.1 Whole blood 6.95E-01 -1.04E-01 -6.81E-01
Behcet's disease 4A62 Peripheral blood 7.72E-01 1.53E-03 4.39E-03
Bipolar disorder 6A60-6A6Z Prefrontal cortex 8.35E-01 -7.08E-03 -3.26E-02
Bladder cancer 2C94 Bladder tissue 1.90E-02 -4.68E-01 -1.60E+00
Breast cancer 2C60-2C6Z Breast tissue 3.88E-43 3.38E-01 1.05E+00
Cardioembolic stroke 8B11.20 Whole blood 4.84E-03 -1.77E-01 -6.92E-01
Cervical cancer 2C77 Cervical tissue 9.77E-02 6.59E-02 2.28E-01
Childhood onset rheumatic disease FA20.Z Peripheral blood 5.96E-01 6.07E-02 7.97E-02
Chronic hepatitis C 1E51.1 Whole blood 9.22E-01 6.47E-02 2.53E-01
Chronic obstructive pulmonary disease CA22 Lung tissue 3.63E-01 -1.22E-01 -5.54E-01
Chronic obstructive pulmonary disease CA22 Small airway epithelium 7.63E-05 -1.67E-01 -6.67E-01
Chronic rhinosinusitis CA0A Sinus mucosa tissue 3.91E-01 -6.75E-02 -4.67E-01
Colon cancer 2B90 Colon tissue 9.47E-08 2.20E-01 5.21E-01
Coronary artery disease BA80-BA8Z Peripheral blood 2.59E-01 -5.83E-02 -3.43E-01
Diffuse large B-cell lymphoma 2A81 Tonsil tissue 2.95E-01 1.40E-01 3.97E-01
Endometriosis GA10 Endometrium tissue 4.81E-01 -1.69E-01 -4.67E-01
Familial hypercholesterolemia 5C80.00 Peripheral blood 6.23E-01 1.59E-01 6.13E-01
Familial hypercholesterolemia 5C80.00 Whole blood 2.28E-01 -1.02E-01 -5.68E-01
Gastric cancer 2B72 Gastric tissue 1.35E-01 4.97E-01 9.09E-01
Glioblastopma 2A00.00 Nervous tissue 3.49E-19 2.85E-01 6.18E-01
Glioma 2A00.0Y-2A00.0Z Brain stem tissue 1.55E-02 3.41E-01 5.35E+00
Glioma 2A00.0Y-2A00.0Z White matter tissue 2.04E-01 3.89E-02 1.79E-01
Head and neck cancer 2D42 Head and neck tissue 7.86E-08 2.28E-01 8.36E-01
HIV-associated neurocognitive impairment 8A2Y-8A2Z White matter tissue 4.61E-01 -6.12E-02 -2.07E-01
Huntington's disease 8A01.10 Whole blood 1.54E-02 -2.51E-01 -1.43E+00
Idiopathic pulmonary fibrosis CB03.4 Lung tissue 2.72E-01 1.77E-01 5.02E-01
Immunodeficiency 4A00-4A20 Peripheral blood 8.25E-01 -3.02E-03 -3.08E-02
Influenza 1E30 Whole blood 9.75E-04 -1.18E+00 -5.58E+00
Interstitial cystitis GC00.3 Bladder tissue 5.25E-02 -1.30E-01 -7.84E-01
Intracranial aneurysm 8B01.0 Intracranial artery 7.61E-01 1.10E-01 3.07E-01
Irritable bowel syndrome DD91.0 Rectal colon tissue 9.17E-02 8.83E-02 3.95E-01
Ischemic stroke 8B11 Peripheral blood 9.45E-01 5.30E-02 2.15E-01
Juvenile idiopathic arthritis FA24 Peripheral blood 7.27E-01 1.08E-04 2.43E-04
Lateral sclerosis 8B60.4 Skin 5.02E-01 1.94E-01 7.33E-01
Lateral sclerosis 8B60.4 Cervical spinal cord 6.55E-02 1.52E-01 1.27E+00
Liver cancer 2C12.0 Liver tissue 4.75E-02 -8.25E-02 -2.67E-01
Liver failure DB99.7-DB99.8 Liver tissue 4.73E-04 -4.96E-01 -1.91E+00
Lung cancer 2C25 Lung tissue 6.33E-26 2.18E-01 7.78E-01
Lupus erythematosus 4A40 Whole blood 4.27E-02 3.21E-01 4.22E-01
Major depressive disorder 6A70-6A7Z Hippocampus 7.95E-01 -2.91E-03 -1.37E-02
Major depressive disorder 6A70-6A7Z Whole blood 3.47E-01 -5.50E-02 -1.30E-01
Melanoma 2C30 Skin 6.80E-02 -2.86E-01 -6.07E-01
Multiple myeloma 2A83.1 Peripheral blood 4.12E-01 -7.34E-02 -2.31E-01
Multiple myeloma 2A83.1 Bone marrow 9.09E-06 9.26E-01 3.70E+00
Multiple sclerosis 8A40 Plasmacytoid dendritic cells 8.97E-01 1.19E-01 2.34E-01
Myelodysplastic syndrome 2A36-2A3Z Bone marrow 7.73E-02 6.47E-02 1.69E-01
Myelofibrosis 2A20.2 Whole blood 4.83E-01 1.39E-01 4.96E-01
Myocardial infarction BA41-BA50 Peripheral blood 8.97E-03 -3.46E-01 -4.37E-01
Myopathy 8C70.6 Muscle tissue 2.05E-01 -1.32E-01 -3.84E-01
Neonatal sepsis KA60 Whole blood 1.02E-11 -4.28E-01 -1.03E+00
Neuroectodermal tumour 2A00.11 Brain stem tissue 4.10E-08 1.16E+00 4.13E+00
Non-alcoholic fatty liver disease DB92 Liver tissue 8.76E-01 3.11E-02 2.14E-01
Obesity related type 2 diabetes 5A11 Omental adipose tissue 9.05E-02 -1.25E-01 -1.53E+00
Olive pollen allergy CA08.00 Peripheral blood 9.81E-02 -3.17E-01 -1.27E+00
Oral cancer 2B6E Oral tissue 5.96E-05 5.24E-01 1.00E+00
Osteoarthritis FA00-FA0Z Synovial tissue 1.24E-01 2.98E-01 1.11E+00
Osteoporosis FB83.1 Bone marrow 8.26E-01 1.66E-01 4.41E-01
Ovarian cancer 2C73 Ovarian tissue 5.82E-04 4.07E-01 1.36E+00
Pancreatic cancer 2C10 Pancreas 7.36E-01 -2.35E-02 -1.20E-01
Parkinson's disease 8A00.0 Substantia nigra tissue 1.68E-01 1.09E-02 6.13E-02
Pediatric respiratory syncytial virus infection CA40.11 Peripheral blood 1.78E-01 -1.41E-01 -4.34E-01
Pituitary cancer 2D12 Pituitary tissue 9.12E-03 3.41E-01 1.48E+00
Pituitary gonadotrope tumour 2D12 Pituitary tissue 7.92E-03 3.46E-01 1.38E+00
Polycystic ovary syndrome 5A80.1 Vastus lateralis muscle 4.17E-01 1.05E-01 4.94E-01
Polycythemia vera 2A20.4 Whole blood 2.72E-01 -8.86E-02 -3.33E-01
Pompe disease 5C51.3 Biceps muscle 8.34E-03 -1.58E-01 -7.98E-01
Preterm birth KA21.4Z Myometrium 6.98E-01 2.57E-02 1.21E-01
Prostate cancer 2C82 Prostate 8.74E-06 1.12E+00 1.41E+00
Psoriasis EA90 Skin 8.31E-14 4.94E-01 1.26E+00
Rectal cancer 2B92 Rectal colon tissue 1.47E-03 3.84E-01 1.86E+00
Renal cancer 2C90-2C91 Kidney 1.70E-02 3.37E-01 9.05E-01
Retinoblastoma 2D02.2 Uvea 5.13E-01 3.18E-02 1.97E-01
Rheumatoid arthritis FA20 Synovial tissue 5.61E-01 1.04E-01 4.05E-01
Rhinovirus infection CA42.1 Nasal epithelium tissue 5.08E-01 3.56E-02 2.10E-01
Schizophrenia 6A20 Prefrontal cortex 7.18E-01 1.11E-01 2.18E-01
Schizophrenia 6A20 Superior temporal cortex 9.78E-01 -1.20E-02 -1.13E-01
Scleroderma 4A42.Z Whole blood 4.39E-01 -1.10E-02 -6.86E-02
Seizure 8A60-8A6Z Whole blood 4.22E-01 3.74E-01 1.00E+00
Sensitive skin EK0Z Skin 8.09E-01 5.69E-02 3.80E-01
Sepsis with septic shock 1G41 Whole blood 5.92E-31 -5.77E-01 -1.44E+00
Shwachman-Diamond syndrome 3A70.0 Bone marrow 7.46E-01 -1.77E-01 -3.69E-01
Sickle cell disease 3A51.0-3A51.3 Peripheral blood 1.33E-02 -1.93E-01 -8.17E-01
Simpson golabi behmel syndrome LD2C Adipose tissue 5.84E-01 -3.65E-01 -6.39E-01
Sjogren's syndrome 4A43.2 Salivary gland tissue 6.62E-01 -1.92E-02 -7.09E-02
Skin cancer 2C30-2C3Z Skin 5.78E-15 3.07E-01 5.86E-01
Thrombocythemia 3B63 Whole blood 9.62E-02 -1.43E-01 -5.18E-01
Thrombocytopenia 3B64 Whole blood 4.26E-01 -3.30E-01 -3.30E-01
Thyroid cancer 2D10 Thyroid 1.16E-03 -1.06E-01 -3.78E-01
Tibial muscular dystrophy 8C75 Muscle tissue 2.02E-01 2.27E-02 9.48E-02
Tuberous sclerosis complex LD2D.2 Perituberal tissue 1.30E-01 -1.26E-01 -7.11E-01
Type 2 diabetes 5A11 Liver tissue 6.15E-01 6.87E-02 3.95E-01
Ureter cancer 2C92 Urothelium 9.90E-01 -2.09E-02 -1.51E-01
Uterine cancer 2C78 Endometrium tissue 1.04E-20 3.39E-01 9.08E-01
Vitiligo ED63.0 Skin 9.07E-01 -4.79E-02 -3.00E-01
------------------------------------------------------------------------------------
⏷ Show the Full List of DME Expression Under 107 Diseases

References

1 UPF0586 protein C9orf41 homolog is anserine-producing methyltransferase. J Biol Chem. 2015 Jul 10;290(28):17190-205.