Details of Drug-Metabolizing Enzyme (DME)

General Information of Drug-Metabolizing Enzyme (DME) (ID: DEDI4B8)

DME Name Fatty acid desaturase 2 (FADS2)
Synonyms Acyl-CoA 6-desaturase; Delta(6) desaturase; Delta(6) fatty acid desaturase; Delta-6 desaturase; D6D; FADS2
Gene Name FADS2
UniProt ID
FADS2_HUMAN
INTEDE ID
DME0203
3D Structure
Download
2D Sequence (FASTA)
Download
3D Structure (PDB)
Download
Gene ID
9415
EC Number EC: 1.14.19.3
Oxidoreductase
Oxygen paired donor oxidoreductase
Oxygen paired donor oxidoreductase
EC: 1.14.19.3
Lineage Species: Homo sapiens
Kingdom: Metazoa
Phylum: Chordata
Class: Mammalia
Order: Primates
Family: Hominidae
Genus: Homo
Species: Homo sapiens
Sequence
MGKGGNQGEGAAEREVSVPTFSWEEIQKHNLRTDRWLVIDRKVYNITKWSIQHPGGQRVI
GHYAGEDATDAFRAFHPDLEFVGKFLKPLLIGELAPEEPSQDHGKNSKITEDFRALRKTA
EDMNLFKTNHVFFLLLLAHIIALESIAWFTVFYFGNGWIPTLITAFVLATSQAQAGWLQH
DYGHLSVYRKPKWNHLVHKFVIGHLKGASANWWNHRHFQHHAKPNIFHKDPDVNMLHVFV
LGEWQPIEYGKKKLKYLPYNHQHEYFFLIGPPLLIPMYFQYQIIMTMIVHKNWVDLAWAV
SYYIRFFITYIPFYGILGALLFLNFIRFLESHWFVWVTQMNHIVMEIDQEAYRDWFSSQL
TATCNVEQSFFNDWFSGHLNFQIEHHLFPTMPRHNLHKIAPLVKSLCAKHGIEYQEKPLL
RALLDIIRSLKKSGKLWLDAYLHK
Function
This enzyme acts as a fatty acyl-coenzyme A (CoA) desaturase that introduces a cis double bond at carbon 6 of the fatty acyl chain. It is involved in biosynthesis of highly unsaturated fatty acids (HUFA) from the essential polyunsaturated fatty acids (PUFA) linoleic acid (LA) (18:2n-6) and alpha-linolenic acid (ALA) (18:3n-3) precursors. It catalyzes the first and rate limiting step in this pathway which is the desaturation of LA (18:2n-6) and ALA (18:3n-3) into gamma-linoleate (GLA) (18:3n-6) and stearidonate (18:4n-3), respectively. Subsequently, in the biosynthetic pathway of HUFA n- 3 series, desaturates tetracosapentaenoate (24:5n-3) to tetracosahexaenoate (24:6n-3), which is then converted to docosahexaenoate (DHA)(22:6n-3), an important lipid for nervous system function.
KEGG Pathway
Biosynthesis of unsaturated fatty acids (hsa01040 )
Fatty acid metabolism (hsa01212 )
Metabolic pathways (hsa01100 )
PPAR signaling pathway (hsa03320 )
alpha-Linolenic acid metabolism (hsa00592 )
Reactome Pathway
alpha-linolenic acid (ALA) metabolism (R-HSA-2046106 )
Linoleic acid (LA) metabolism (R-HSA-2046105 )

Molecular Interaction Atlas (MIA) of This DME

Molecular Interaction Atlas (MIA) Jump to Detail Molecular Interaction Atlas of This DME
1 Clinical Trial Drug(s) Metabolized by This DME
Drug Name Drug ID Indication ICD 11 Highest Status REF
Omega-6-FA DMBWY8V N. A. N. A. Phase 3 [1]

Molecular Expression Atlas (MEA) of This DME

Molecular Expression Atlas (MEA) Jump to Detail Molecular Expression Atlas of This DME
Disease Name ICD 11 Studied Tissue p-value Fold-Change Z-score
Acute myelocytic leukaemia 2B33.1 Bone marrow 1.60E-07 1.40E-01 5.32E-01
Alopecia ED70 Skin from scalp 3.82E-02 1.74E-01 2.47E-01
Alzheimer's disease 8A20 Entorhinal cortex 6.17E-03 1.32E-01 5.76E-01
Ankylosing spondylitis FA92.0 Pheripheral blood 5.20E-01 -2.26E-02 -1.33E-01
Aortic stenosis BB70 Calcified aortic valve 2.93E-01 3.04E-02 9.96E-02
Apnea 7A40 Hyperplastic tonsil 6.39E-01 -6.44E-02 -3.23E-01
Arthropathy FA00-FA5Z Peripheral blood 3.04E-01 1.40E-01 7.21E-01
Asthma CA23 Nasal and bronchial airway 1.02E-02 -1.33E-01 -3.58E-01
Atopic dermatitis EA80 Skin 7.40E-01 -2.90E-01 -3.60E-01
Autism 6A02 Whole blood 9.40E-01 1.70E-02 6.90E-02
Autoimmune uveitis 9A96 Peripheral monocyte 1.66E-01 -3.73E-01 -2.24E+00
Autosomal dominant monocytopenia 4B04 Whole blood 4.59E-01 1.04E-02 5.61E-02
Bacterial infection of gingival 1C1H Gingival tissue 1.20E-08 2.62E-01 1.08E+00
Batten disease 5C56.1 Whole blood 2.49E-01 1.02E-01 6.20E-01
Behcet's disease 4A62 Peripheral blood 1.47E-01 -2.07E-01 -6.72E-01
Bipolar disorder 6A60-6A6Z Prefrontal cortex 6.19E-01 -4.94E-02 -3.21E-01
Bladder cancer 2C94 Bladder tissue 2.95E-01 -8.55E-03 -2.63E-02
Breast cancer 2C60-2C6Z Breast tissue 8.37E-17 3.07E-01 6.57E-01
Cardioembolic stroke 8B11.20 Whole blood 3.36E-02 -1.35E-01 -3.98E-01
Cervical cancer 2C77 Cervical tissue 1.07E-04 1.98E-01 9.61E-01
Childhood onset rheumatic disease FA20.Z Peripheral blood 1.62E-01 1.52E-01 7.48E-01
Chronic hepatitis C 1E51.1 Whole blood 7.69E-01 -4.42E-04 -2.93E-03
Chronic obstructive pulmonary disease CA22 Lung tissue 1.79E-01 -1.16E-01 -4.51E-01
Chronic obstructive pulmonary disease CA22 Small airway epithelium 7.12E-03 8.07E-02 3.37E-01
Chronic rhinosinusitis CA0A Sinus mucosa tissue 8.94E-01 -1.39E-01 -1.55E+00
Colon cancer 2B90 Colon tissue 1.05E-12 1.16E-01 4.63E-01
Coronary artery disease BA80-BA8Z Peripheral blood 1.92E-01 1.16E-01 8.12E-01
Diffuse large B-cell lymphoma 2A81 Tonsil tissue 4.21E-01 -1.05E-01 -4.04E-01
Endometriosis GA10 Endometrium tissue 6.45E-01 -1.17E-01 -2.26E-01
Familial hypercholesterolemia 5C80.00 Peripheral blood 5.85E-01 3.24E-02 1.93E-01
Familial hypercholesterolemia 5C80.00 Whole blood 8.36E-02 2.04E-01 9.63E-01
Gastric cancer 2B72 Gastric tissue 7.74E-01 -1.60E-01 -5.28E-01
Glioblastopma 2A00.00 Nervous tissue 6.05E-03 -6.67E-03 -1.84E-02
Glioma 2A00.0Y-2A00.0Z Brain stem tissue 1.39E-03 6.17E-01 7.38E+00
Glioma 2A00.0Y-2A00.0Z White matter tissue 5.22E-02 1.16E-01 5.34E-01
Head and neck cancer 2D42 Head and neck tissue 5.36E-11 2.59E-01 7.53E-01
HIV-associated neurocognitive impairment 8A2Y-8A2Z White matter tissue 7.93E-01 -3.04E-02 -1.71E-01
Huntington's disease 8A01.10 Whole blood 1.19E-01 3.13E-01 1.80E+00
Idiopathic pulmonary fibrosis CB03.4 Lung tissue 4.71E-01 -1.10E-01 -7.06E-01
Immunodeficiency 4A00-4A20 Peripheral blood 9.03E-01 4.99E-02 4.59E-01
Influenza 1E30 Whole blood 5.13E-02 3.16E-01 2.36E+00
Interstitial cystitis GC00.3 Bladder tissue 2.72E-01 1.60E-01 9.00E-01
Intracranial aneurysm 8B01.0 Intracranial artery 4.99E-02 -7.09E-02 -1.90E-01
Irritable bowel syndrome DD91.0 Rectal colon tissue 1.11E-02 -7.97E-02 -2.88E-01
Ischemic stroke 8B11 Peripheral blood 1.20E-01 6.76E-02 2.94E-01
Juvenile idiopathic arthritis FA24 Peripheral blood 6.37E-01 8.99E-02 2.82E-01
Lateral sclerosis 8B60.4 Skin 5.23E-02 -2.07E-01 -1.14E+00
Lateral sclerosis 8B60.4 Cervical spinal cord 4.31E-02 2.21E-01 1.83E+00
Liver cancer 2C12.0 Liver tissue 7.20E-01 -3.86E-02 -8.17E-02
Liver failure DB99.7-DB99.8 Liver tissue 1.01E-02 -2.92E-01 -9.33E-01
Lung cancer 2C25 Lung tissue 9.72E-01 -3.19E-03 -1.27E-02
Lupus erythematosus 4A40 Whole blood 1.11E-02 -1.19E-01 -2.49E-01
Major depressive disorder 6A70-6A7Z Hippocampus 1.94E-02 -1.05E-01 -7.05E-01
Major depressive disorder 6A70-6A7Z Whole blood 7.95E-02 6.48E-02 3.10E-01
Melanoma 2C30 Skin 9.90E-06 -1.99E+00 -1.49E+00
Multiple myeloma 2A83.1 Peripheral blood 5.71E-01 -2.85E-01 -5.16E-01
Multiple myeloma 2A83.1 Bone marrow 9.70E-03 2.57E-01 1.08E+00
Multiple sclerosis 8A40 Plasmacytoid dendritic cells 3.14E-02 2.39E-01 1.06E+00
Myelodysplastic syndrome 2A36-2A3Z Bone marrow 8.30E-01 3.86E-02 2.18E-01
Myelofibrosis 2A20.2 Whole blood 4.76E-01 -1.28E-02 -9.43E-02
Myocardial infarction BA41-BA50 Peripheral blood 1.90E-02 4.52E-01 9.25E-01
Myopathy 8C70.6 Muscle tissue 3.54E-02 -1.06E-01 -1.61E+00
Neonatal sepsis KA60 Whole blood 6.19E-02 7.39E-02 2.60E-01
Neuroectodermal tumour 2A00.11 Brain stem tissue 1.88E-05 -6.26E-01 -2.20E+00
Non-alcoholic fatty liver disease DB92 Liver tissue 1.70E-01 1.76E-01 5.34E-01
Obesity related type 2 diabetes 5A11 Omental adipose tissue 5.46E-01 -9.78E-02 -8.34E-01
Olive pollen allergy CA08.00 Peripheral blood 3.07E-01 8.86E-02 6.08E-01
Oral cancer 2B6E Oral tissue 1.57E-01 -3.04E-01 -7.35E-01
Osteoarthritis FA00-FA0Z Synovial tissue 5.12E-01 -4.72E-02 -1.57E-01
Osteoporosis FB83.1 Bone marrow 3.28E-02 1.22E-01 1.38E+00
Ovarian cancer 2C73 Ovarian tissue 5.96E-01 -2.20E-01 -4.07E-01
Pancreatic cancer 2C10 Pancreas 1.64E-01 -3.39E-01 -7.87E-01
Parkinson's disease 8A00.0 Substantia nigra tissue 1.98E-01 -2.78E-02 -1.10E-01
Pediatric respiratory syncytial virus infection CA40.11 Peripheral blood 9.78E-01 1.55E-02 8.73E-02
Pituitary cancer 2D12 Pituitary tissue 1.48E-05 7.43E-01 2.71E+00
Pituitary gonadotrope tumour 2D12 Pituitary tissue 4.99E-07 8.52E-01 3.74E+00
Polycystic ovary syndrome 5A80.1 Vastus lateralis muscle 6.97E-01 -2.90E-02 -1.57E-01
Polycythemia vera 2A20.4 Whole blood 1.62E-01 8.18E-02 5.41E-01
Pompe disease 5C51.3 Biceps muscle 6.19E-01 -2.52E-02 -2.52E-01
Preterm birth KA21.4Z Myometrium 1.31E-01 -3.79E-01 -1.29E+00
Prostate cancer 2C82 Prostate 4.11E-03 -1.01E+00 -9.77E-01
Psoriasis EA90 Skin 1.26E-21 -1.26E+00 -1.67E+00
Rectal cancer 2B92 Rectal colon tissue 8.60E-01 5.85E-02 2.68E-01
Renal cancer 2C90-2C91 Kidney 7.65E-04 -2.00E-01 -1.22E+00
Retinoblastoma 2D02.2 Uvea 1.48E-10 -9.33E-01 -4.82E+00
Rheumatoid arthritis FA20 Synovial tissue 2.16E-01 1.31E-01 4.07E-01
Rhinovirus infection CA42.1 Nasal epithelium tissue 7.74E-01 -7.38E-02 -4.29E-01
Schizophrenia 6A20 Prefrontal cortex 5.31E-01 -2.78E-02 -8.85E-02
Schizophrenia 6A20 Superior temporal cortex 2.74E-01 -3.47E-02 -2.28E-01
Scleroderma 4A42.Z Whole blood 2.09E-01 -1.85E-01 -7.70E-01
Seizure 8A60-8A6Z Whole blood 1.13E-01 -2.10E-01 -1.26E+00
Sensitive skin EK0Z Skin 9.50E-01 7.98E-03 3.76E-02
Sepsis with septic shock 1G41 Whole blood 1.43E-01 3.64E-02 1.32E-01
Shwachman-Diamond syndrome 3A70.0 Bone marrow 1.27E-01 -9.35E-02 -6.62E-01
Sickle cell disease 3A51.0-3A51.3 Peripheral blood 1.03E-01 1.62E-01 6.64E-01
Simpson golabi behmel syndrome LD2C Adipose tissue 5.63E-01 1.15E-01 1.89E-01
Sjogren's syndrome 4A43.2 Salivary gland tissue 2.30E-01 -3.90E-01 -1.74E+00
Skin cancer 2C30-2C3Z Skin 1.12E-38 -1.16E+00 -1.30E+00
Thrombocythemia 3B63 Whole blood 3.57E-01 9.33E-02 6.77E-01
Thrombocytopenia 3B64 Whole blood 4.02E-01 1.06E-01 3.99E-01
Thyroid cancer 2D10 Thyroid 1.99E-06 1.33E-01 6.11E-01
Tibial muscular dystrophy 8C75 Muscle tissue 9.79E-01 7.74E-02 4.00E-01
Tuberous sclerosis complex LD2D.2 Perituberal tissue 3.82E-02 2.10E-01 1.87E+00
Type 2 diabetes 5A11 Liver tissue 8.65E-01 -7.58E-03 -2.31E-02
Ureter cancer 2C92 Urothelium 2.08E-01 1.47E-01 6.15E-01
Uterine cancer 2C78 Endometrium tissue 8.64E-06 -2.65E-01 -5.03E-01
Vitiligo ED63.0 Skin 6.77E-01 -7.62E-01 -7.74E-01
------------------------------------------------------------------------------------
⏷ Show the Full List of DME Expression Under 107 Diseases

The Drug Therapeutic Target (DTT) Role of This DME

DME DTT Name Fatty acid desaturase 2 (FADS2) DTT Info
DME DTT Type Literature-reported

References

1 Health implications of high dietary omega-6 polyunsaturated Fatty acids. J Nutr Metab. 2012;2012:539426.