Details of Drug-Metabolizing Enzyme (DME)

General Information of Drug-Metabolizing Enzyme (DME) (ID: DEDMAGE)

DME Name Brain form hexokinase (HK1)
Synonyms Hexokinase-A; Hexokinase type I; Hexokinase-1; HK I; HK1
Gene Name HK1
UniProt ID
HXK1_HUMAN
INTEDE ID
DME0476
3D Structure
Download
2D Sequence (FASTA)
Download
3D Structure (PDB)
Download
Gene ID
3098
EC Number EC: 2.7.1.1
Transferase
Kinase
Phosphotransferase
EC: 2.7.1.1
Lineage Species: Homo sapiens
Kingdom: Metazoa
Phylum: Chordata
Class: Mammalia
Order: Primates
Family: Hominidae
Genus: Homo
Species: Homo sapiens
Sequence
MIAAQLLAYYFTELKDDQVKKIDKYLYAMRLSDETLIDIMTRFRKEMKNGLSRDFNPTAT
VKMLPTFVRSIPDGSEKGDFIALDLGGSSFRILRVQVNHEKNQNVHMESEVYDTPENIVH
GSGSQLFDHVAECLGDFMEKRKIKDKKLPVGFTFSFPCQQSKIDEAILITWTKRFKASGV
EGADVVKLLNKAIKKRGDYDANIVAVVNDTVGTMMTCGYDDQHCEVGLIIGTGTNACYME
ELRHIDLVEGDEGRMCINTEWGAFGDDGSLEDIRTEFDREIDRGSLNPGKQLFEKMVSGM
YLGELVRLILVKMAKEGLLFEGRITPELLTRGKFNTSDVSAIEKNKEGLHNAKEILTRLG
VEPSDDDCVSVQHVCTIVSFRSANLVAATLGAILNRLRDNKGTPRLRTTVGVDGSLYKTH
PQYSRRFHKTLRRLVPDSDVRFLLSESGSGKGAAMVTAVAYRLAEQHRQIEETLAHFHLT
KDMLLEVKKRMRAEMELGLRKQTHNNAVVKMLPSFVRRTPDGTENGDFLALDLGGTNFRV
LLVKIRSGKKRTVEMHNKIYAIPIEIMQGTGEELFDHIVSCISDFLDYMGIKGPRMPLGF
TFSFPCQQTSLDAGILITWTKGFKATDCVGHDVVTLLRDAIKRREEFDLDVVAVVNDTVG
TMMTCAYEEPTCEVGLIVGTGSNACYMEEMKNVEMVEGDQGQMCINMEWGAFGDNGCLDD
IRTHYDRLVDEYSLNAGKQRYEKMISGMYLGEIVRNILIDFTKKGFLFRGQISETLKTRG
IFETKFLSQIESDRLALLQVRAILQQLGLNSTCDDSILVKTVCGVVSRRAAQLCGAGMAA
VVDKIRENRGLDRLNVTVGVDGTLYKLHPHFSRIMHQTVKELSPKCNVSFLLSEDGSGKG
AALITAVGVRLRTEASS
Function
This enzyme catalyzes the phosphorylation of various hexoses, such as D-glucose, D-glucosamine, D-fructose, D-mannose and 2-deoxy-D-glucose, to hexose 6-phosphate (D-glucose 6-phosphate, D-glucosamine 6-phosphate, D-fructose 6-phosphate, D-mannose 6-phosphate and 2-deoxy-D-glucose 6- phosphate, respectively) but does not phosphorylate N-acetyl-D-glucosamine.
KEGG Pathway
Amino sugar and nucleotide sugar metabolism (hsa00520 )
Carbohydrate digestion and absorption (hsa04973 )
Carbon metabolism (hsa01200 )
Central carbon metabolism in cancer (hsa05230 )
Fructose and mannose metabolism (hsa00051 )
Galactose metabolism (hsa00052 )
Glycolysis / Gluconeogenesis (hsa00010 )
HIF-1 signaling pathway (hsa04066 )
Insulin signaling pathway (hsa04910 )
Metabolic pathways (hsa01100 )
Neomycin, kanamycin and gentamicin biosynthesis (hsa00524 )
Shigellosis (hsa05131 )
Starch and sucrose metabolism (hsa00500 )
Type II diabetes mellitus (hsa04930 )
Reactome Pathway
Glycolysis (R-HSA-70171 )
Defective HK1 causes hexokinase deficiency (HK deficiency) (R-HSA-5619056 )

Molecular Interaction Atlas (MIA) of This DME

Molecular Interaction Atlas (MIA) Jump to Detail Molecular Interaction Atlas of This DME
1 Investigative Drug(s) Metabolized by This DME
Drug Name Drug ID Indication ICD 11 Highest Status REF
D-glucose DMMG2TO Discovery agent N.A. Investigative [1]
Experimental Enzyme Kinetic Data of Drugs
Drug Name Indication Highest Status Kinetic Data REF
D-glucose Discovery agent [N.A.] Investigative Km = 0.057 microM [1]

Molecular Expression Atlas (MEA) of This DME

Molecular Expression Atlas (MEA) Jump to Detail Molecular Expression Atlas of This DME
Disease Name ICD 11 Studied Tissue p-value Fold-Change Z-score
Acute myelocytic leukaemia 2B33.1 Bone marrow 1.14E-16 -3.48E-01 -9.05E-01
Alopecia ED70 Skin from scalp 2.61E-03 1.23E-01 5.60E-01
Alzheimer's disease 8A20 Entorhinal cortex 1.43E-05 -3.07E-01 -8.16E-01
Ankylosing spondylitis FA92.0 Pheripheral blood 9.49E-01 5.20E-03 2.05E-02
Aortic stenosis BB70 Calcified aortic valve 6.81E-01 -1.92E-01 -2.32E-01
Apnea 7A40 Hyperplastic tonsil 7.82E-01 8.25E-02 1.75E-01
Arthropathy FA00-FA5Z Peripheral blood 2.50E-01 6.01E-02 4.30E-01
Asthma CA23 Nasal and bronchial airway 8.25E-04 1.80E-01 2.17E-01
Atopic dermatitis EA80 Skin 1.66E-06 2.30E-01 1.80E+00
Autism 6A02 Whole blood 2.30E-02 4.94E-02 1.72E-01
Autoimmune uveitis 9A96 Peripheral monocyte 8.64E-01 -8.17E-04 -2.44E-03
Autosomal dominant monocytopenia 4B04 Whole blood 3.27E-01 1.53E-01 3.85E-01
Bacterial infection of gingival 1C1H Gingival tissue 5.10E-12 -2.49E-01 -1.07E+00
Batten disease 5C56.1 Whole blood 9.94E-01 2.44E-02 1.07E-01
Behcet's disease 4A62 Peripheral blood 6.25E-01 3.69E-03 2.15E-02
Bipolar disorder 6A60-6A6Z Prefrontal cortex 1.26E-01 -1.96E-02 -1.39E-01
Bladder cancer 2C94 Bladder tissue 4.10E-03 -1.39E-01 -1.12E+00
Breast cancer 2C60-2C6Z Breast tissue 7.90E-32 2.99E-01 8.75E-01
Cardioembolic stroke 8B11.20 Whole blood 6.19E-02 1.04E-01 3.22E-01
Cervical cancer 2C77 Cervical tissue 1.23E-07 -5.03E-01 -1.81E+00
Childhood onset rheumatic disease FA20.Z Peripheral blood 1.56E-01 1.89E-01 3.86E-01
Chronic hepatitis C 1E51.1 Whole blood 8.86E-01 -1.67E-01 -7.23E-01
Chronic obstructive pulmonary disease CA22 Lung tissue 2.90E-01 -5.83E-02 -2.33E-01
Chronic obstructive pulmonary disease CA22 Small airway epithelium 7.80E-01 6.32E-02 2.23E-01
Chronic rhinosinusitis CA0A Sinus mucosa tissue 5.90E-02 -4.53E-01 -1.01E+00
Colon cancer 2B90 Colon tissue 9.61E-02 7.60E-02 2.30E-01
Coronary artery disease BA80-BA8Z Peripheral blood 1.96E-01 -2.18E-01 -7.87E-01
Diffuse large B-cell lymphoma 2A81 Tonsil tissue 3.42E-01 -2.42E-02 -1.83E-01
Endometriosis GA10 Endometrium tissue 6.75E-01 5.39E-02 1.20E-01
Familial hypercholesterolemia 5C80.00 Peripheral blood 1.38E-01 9.16E-02 8.28E-01
Familial hypercholesterolemia 5C80.00 Whole blood 5.82E-14 9.02E-01 2.24E+00
Gastric cancer 2B72 Gastric tissue 6.33E-04 -6.74E-01 -9.98E+00
Glioblastopma 2A00.00 Nervous tissue 2.09E-116 -1.05E+00 -1.86E+00
Glioma 2A00.0Y-2A00.0Z Brain stem tissue 3.28E-01 -6.26E-01 -1.18E+00
Glioma 2A00.0Y-2A00.0Z White matter tissue 8.44E-04 1.59E+00 1.80E+00
Head and neck cancer 2D42 Head and neck tissue 2.62E-05 -2.08E-01 -5.37E-01
HIV-associated neurocognitive impairment 8A2Y-8A2Z White matter tissue 9.51E-01 2.25E-02 2.82E-02
Huntington's disease 8A01.10 Whole blood 2.73E-01 1.16E-01 5.01E-01
Idiopathic pulmonary fibrosis CB03.4 Lung tissue 7.55E-01 7.84E-02 4.20E-01
Immunodeficiency 4A00-4A20 Peripheral blood 1.33E-02 1.36E-01 1.44E+00
Influenza 1E30 Whole blood 9.83E-01 -8.24E-02 -3.43E-01
Interstitial cystitis GC00.3 Bladder tissue 2.62E-03 -3.80E-01 -2.63E+00
Intracranial aneurysm 8B01.0 Intracranial artery 2.44E-02 4.26E-01 1.04E+00
Irritable bowel syndrome DD91.0 Rectal colon tissue 1.96E-01 -1.22E-01 -3.16E-01
Ischemic stroke 8B11 Peripheral blood 1.93E-01 -1.44E-02 -8.22E-02
Juvenile idiopathic arthritis FA24 Peripheral blood 9.42E-01 -1.20E-01 -3.10E-01
Lateral sclerosis 8B60.4 Skin 6.57E-01 2.62E-03 1.01E-02
Lateral sclerosis 8B60.4 Cervical spinal cord 7.95E-01 -2.91E-01 -3.60E-01
Liver cancer 2C12.0 Liver tissue 8.62E-01 -7.92E-02 -1.39E-01
Liver failure DB99.7-DB99.8 Liver tissue 1.76E-05 1.48E+00 3.14E+00
Lung cancer 2C25 Lung tissue 5.41E-03 1.03E-01 4.50E-01
Lupus erythematosus 4A40 Whole blood 4.85E-05 -1.66E-01 -4.08E-01
Major depressive disorder 6A70-6A7Z Hippocampus 7.62E-01 7.87E-03 5.48E-02
Major depressive disorder 6A70-6A7Z Whole blood 2.11E-02 4.64E-02 1.28E-01
Melanoma 2C30 Skin 4.79E-01 -1.88E-01 -2.93E-01
Multiple myeloma 2A83.1 Peripheral blood 9.82E-01 -5.24E-02 -7.25E-02
Multiple myeloma 2A83.1 Bone marrow 4.27E-04 4.30E-01 1.98E+00
Multiple sclerosis 8A40 Plasmacytoid dendritic cells 4.16E-01 -1.09E-01 -3.89E-01
Myelodysplastic syndrome 2A36-2A3Z Bone marrow 7.08E-04 2.16E-01 6.40E-01
Myelofibrosis 2A20.2 Whole blood 2.17E-03 3.41E-01 1.46E+00
Myocardial infarction BA41-BA50 Peripheral blood 5.49E-01 9.08E-03 1.10E-02
Myopathy 8C70.6 Muscle tissue 4.94E-01 -7.29E-02 -2.05E-01
Neonatal sepsis KA60 Whole blood 1.61E-18 6.16E-01 1.50E+00
Neuroectodermal tumour 2A00.11 Brain stem tissue 4.56E-01 2.73E-02 8.62E-02
Non-alcoholic fatty liver disease DB92 Liver tissue 8.30E-01 1.19E-01 6.26E-01
Obesity related type 2 diabetes 5A11 Omental adipose tissue 5.26E-01 2.92E-02 5.02E-02
Olive pollen allergy CA08.00 Peripheral blood 6.78E-01 1.80E-02 5.17E-02
Oral cancer 2B6E Oral tissue 2.88E-01 -1.63E-01 -3.61E-01
Osteoarthritis FA00-FA0Z Synovial tissue 5.04E-01 2.60E-01 2.70E-01
Osteoporosis FB83.1 Bone marrow 9.70E-01 -5.93E-02 -1.74E-01
Ovarian cancer 2C73 Ovarian tissue 2.28E-02 1.58E-01 2.41E-01
Pancreatic cancer 2C10 Pancreas 1.56E-03 3.02E-01 9.11E-01
Parkinson's disease 8A00.0 Substantia nigra tissue 1.62E-01 -3.73E-01 -6.46E-01
Pediatric respiratory syncytial virus infection CA40.11 Peripheral blood 8.27E-05 2.47E-01 1.35E+00
Pituitary cancer 2D12 Pituitary tissue 4.00E-01 2.65E-02 1.14E-01
Pituitary gonadotrope tumour 2D12 Pituitary tissue 4.38E-02 -3.75E-01 -1.29E+00
Polycystic ovary syndrome 5A80.1 Vastus lateralis muscle 1.66E-01 1.75E-01 5.19E-01
Polycythemia vera 2A20.4 Whole blood 4.21E-01 -8.33E-03 -3.36E-02
Pompe disease 5C51.3 Biceps muscle 1.44E-06 1.37E+00 3.12E+00
Preterm birth KA21.4Z Myometrium 2.41E-01 -3.22E-01 -8.33E-01
Prostate cancer 2C82 Prostate 5.39E-09 -1.30E+00 -2.29E+00
Psoriasis EA90 Skin 6.09E-11 -9.36E-02 -3.16E-01
Rectal cancer 2B92 Rectal colon tissue 7.95E-01 -2.59E-02 -1.20E-01
Renal cancer 2C90-2C91 Kidney 1.36E-01 1.50E-01 2.79E-01
Retinoblastoma 2D02.2 Uvea 7.95E-07 -1.40E+00 -1.37E+01
Rheumatoid arthritis FA20 Synovial tissue 4.07E-04 7.88E-01 2.46E+00
Rhinovirus infection CA42.1 Nasal epithelium tissue 9.75E-01 2.26E-02 1.37E-01
Schizophrenia 6A20 Prefrontal cortex 1.32E-01 -1.09E-01 -3.71E-01
Schizophrenia 6A20 Superior temporal cortex 7.53E-01 3.18E-02 1.11E-01
Scleroderma 4A42.Z Whole blood 7.01E-02 1.30E-01 9.86E-01
Seizure 8A60-8A6Z Whole blood 3.69E-03 -2.68E-01 -1.09E+00
Sensitive skin EK0Z Skin 8.82E-01 -1.28E-02 -8.71E-02
Sepsis with septic shock 1G41 Whole blood 4.32E-23 3.31E-01 8.52E-01
Shwachman-Diamond syndrome 3A70.0 Bone marrow 1.71E-01 4.01E-01 2.04E+00
Sickle cell disease 3A51.0-3A51.3 Peripheral blood 5.91E-02 2.25E-01 5.97E-01
Simpson golabi behmel syndrome LD2C Adipose tissue 5.49E-02 3.35E-01 1.18E+00
Sjogren's syndrome 4A43.2 Salivary gland tissue 7.27E-02 7.61E-01 2.06E+00
Skin cancer 2C30-2C3Z Skin 2.59E-39 -7.08E-01 -1.38E+00
Thrombocythemia 3B63 Whole blood 1.19E-01 -1.12E-02 -4.69E-02
Thrombocytopenia 3B64 Whole blood 6.40E-01 -3.73E-01 -1.01E+00
Thyroid cancer 2D10 Thyroid 3.78E-40 -8.31E-01 -2.16E+00
Tibial muscular dystrophy 8C75 Muscle tissue 1.91E-03 -4.72E-01 -1.40E+00
Tuberous sclerosis complex LD2D.2 Perituberal tissue 1.35E-01 -2.24E-01 -2.53E+00
Type 2 diabetes 5A11 Liver tissue 6.88E-01 8.14E-02 2.41E-01
Ureter cancer 2C92 Urothelium 9.11E-01 -2.67E-02 -4.51E-02
Uterine cancer 2C78 Endometrium tissue 8.48E-02 2.11E-01 3.71E-01
Vitiligo ED63.0 Skin 1.41E-01 2.06E-01 1.11E+00
------------------------------------------------------------------------------------
⏷ Show the Full List of DME Expression Under 107 Diseases

References

1 Nonaggregating mutant of recombinant human hexokinase I exhibits wild-type kinetics and rod-like conformations in solution. Biochemistry. 1999 Jun 29;38(26):8359-66.