Details of Drug-Metabolizing Enzyme (DME)

General Information of Drug-Metabolizing Enzyme (DME) (ID: DEDZRQ1)

DME Name Cytochrome P450 7A1 (CYP7A1)
Synonyms Cytochrome P450 family 7 subfamily A member 1; Cholesterol 7-alpha-hydroxylase; Cholesterol 7-alpha-monooxygenase; CYP7; CYP7A1; CYPVII
Gene Name CYP7A1
UniProt ID
CP7A1_HUMAN
INTEDE ID
DME0624
3D Structure
Download
2D Sequence (FASTA)
Download
3D Structure (PDB)
Download
Gene ID
1581
EC Number EC: 1.14.14.23
Oxidoreductase
Oxygen paired donor oxidoreductase
Flavin/flavoprotein donor oxidoreductase
EC: 1.14.14.23
Lineage Species: Homo sapiens
Kingdom: Metazoa
Phylum: Chordata
Class: Mammalia
Order: Primates
Family: Hominidae
Genus: Homo
Species: Homo sapiens
Sequence
MMTTSLIWGIAIAACCCLWLILGIRRRQTGEPPLENGLIPYLGCALQFGANPLEFLRANQ
RKHGHVFTCKLMGKYVHFITNPLSYHKVLCHGKYFDWKKFHFATSAKAFGHRSIDPMDGN
TTENINDTFIKTLQGHALNSLTESMMENLQRIMRPPVSSNSKTAAWVTEGMYSFCYRVMF
EAGYLTIFGRDLTRRDTQKAHILNNLDNFKQFDKVFPALVAGLPIHMFRTAHNAREKLAE
SLRHENLQKRESISELISLRMFLNDTLSTFDDLEKAKTHLVVLWASQANTIPATFWSLFQ
MIRNPEAMKAATEEVKRTLENAGQKVSLEGNPICLSQAELNDLPVLDSIIKESLRLSSAS
LNIRTAKEDFTLHLEDGSYNIRKDDIIALYPQLMHLDPEIYPDPLTFKYDRYLDENGKTK
TTFYCNGLKLKYYYMPFGSGATICPGRLFAIHEIKQFLILMLSYFELELIEGQAKCPPLD
QSRAGLGILPPLNDIEFKYKFKHL
Function This enzyme involves in the metabolism of endogenous cholesterol and its oxygenated derivatives.
KEGG Pathway
Bile secretion (hsa04976 )
Cholesterol metabolism (hsa04979 )
Metabolic pathways (hsa01100 )
PPAR signaling pathway (hsa03320 )
Primary bile acid biosynthesis (hsa00120 )
Steroid hormone biosynthesis (hsa00140 )
Reactome Pathway
PPARA activates gene expression (R-HSA-1989781 )
Synthesis of bile acids and bile salts via 27-hydroxycholesterol (R-HSA-193807 )
Synthesis of bile acids and bile salts via 7alpha-hydroxycholesterol (R-HSA-193368 )
Synthesis of bile acids and bile salts (R-HSA-192105 )
Endogenous sterols (R-HSA-211976 )

Molecular Interaction Atlas (MIA) of This DME

Molecular Interaction Atlas (MIA) Jump to Detail Molecular Interaction Atlas of This DME
2 Clinical Trial Drug(s) Metabolized by This DME
Drug Name Drug ID Indication ICD 11 Highest Status REF
ANW-32821 DMMJOZD N. A. N. A. Phase 2 [1]
Bile acid DM9UZD7 Discovery agent N.A. Phase 1 [2]

Molecular Expression Atlas (MEA) of This DME

Molecular Expression Atlas (MEA) Jump to Detail Molecular Expression Atlas of This DME
Disease Name ICD 11 Studied Tissue p-value Fold-Change Z-score
Acute myelocytic leukaemia 2B33.1 Bone marrow 1.63E-01 9.58E-03 9.61E-02
Alzheimer's disease 8A20 Entorhinal cortex 2.75E-01 -2.04E-02 -1.85E-01
Asthma CA23 Nasal and bronchial airway 3.44E-01 5.88E-02 3.17E-01
Behcet's disease 4A62 Peripheral blood 9.51E-01 -4.65E-02 -4.56E-01
Bipolar disorder 6A60-6A6Z Prefrontal cortex 3.51E-02 5.72E-02 8.31E-01
Bladder cancer 2C94 Bladder tissue 5.03E-01 4.39E-03 5.99E-02
Breast cancer 2C60-2C6Z Breast tissue 2.12E-02 -4.07E-02 -2.47E-01
Colon cancer 2B90 Colon tissue 6.79E-11 7.99E-02 5.15E-01
Diffuse large B-cell lymphoma 2A81 Tonsil tissue 5.22E-01 -2.74E-02 -1.66E-01
Familial hypercholesterolemia 5C80.00 Peripheral blood 3.66E-02 1.01E-01 1.15E+00
Gastric cancer 2B72 Gastric tissue 1.36E-01 1.29E-01 1.26E+00
Glioblastopma 2A00.00 Nervous tissue 1.37E-04 4.51E-02 2.78E-01
Head and neck cancer 2D42 Head and neck tissue 1.62E-02 -3.47E-02 -3.32E-01
HIV-associated neurocognitive impairment 8A2Y-8A2Z White matter tissue 8.71E-02 -6.69E-02 -4.92E-01
Idiopathic pulmonary fibrosis CB03.4 Lung tissue 3.43E-01 -1.03E-01 -3.80E-01
Interstitial cystitis GC00.3 Bladder tissue 4.79E-01 4.44E-03 5.10E-02
Ischemic stroke 8B11 Peripheral blood 4.00E-01 -2.46E-02 -2.92E-01
Liver cancer 2C12.0 Liver tissue 6.16E-01 -2.24E-01 -1.03E-01
Liver failure DB99.7-DB99.8 Liver tissue 7.60E-03 -4.23E+00 -1.59E+00
Lung cancer 2C25 Lung tissue 1.88E-02 1.63E-03 1.47E-02
Lupus erythematosus 4A40 Whole blood 5.00E-06 7.02E-02 4.13E-01
Major depressive disorder 6A70-6A7Z Hippocampus 6.19E-03 5.63E-02 7.71E-01
Multiple myeloma 2A83.1 Bone marrow 5.20E-01 -2.09E-02 -2.38E-01
Multiple myeloma 2A83.1 Peripheral blood 6.46E-01 6.98E-03 5.36E-02
Multiple sclerosis 8A40 Plasmacytoid dendritic cells 5.34E-01 -1.87E-02 -9.60E-02
Myelodysplastic syndrome 2A36-2A3Z Bone marrow 2.94E-01 2.56E-02 2.03E-01
Myocardial infarction BA41-BA50 Peripheral blood 9.59E-01 -4.68E-02 -1.31E-01
Neuroectodermal tumour 2A00.11 Brain stem tissue 5.44E-01 8.91E-02 6.06E-01
Non-alcoholic fatty liver disease DB92 Liver tissue 6.64E-01 -2.81E-01 -2.41E-01
Obesity related type 2 diabetes 5A11 Omental adipose tissue 6.58E-01 6.02E-02 3.55E-01
Olive pollen allergy CA08.00 Peripheral blood 6.94E-01 -5.95E-02 -5.62E-01
Oral cancer 2B6E Oral tissue 3.70E-01 2.27E-02 1.90E-01
Ovarian cancer 2C73 Ovarian tissue 2.42E-01 -1.41E-01 -1.16E+00
Pancreatic cancer 2C10 Pancreas 8.88E-01 -9.82E-02 -4.67E-01
Parkinson's disease 8A00.0 Substantia nigra tissue 2.64E-01 -2.91E-02 -4.01E-01
Pituitary cancer 2D12 Pituitary tissue 6.37E-01 1.53E-02 1.51E-01
Polycystic ovary syndrome 5A80.1 Vastus lateralis muscle 1.60E-01 -2.34E-02 -1.78E-01
Pompe disease 5C51.3 Biceps muscle 5.55E-01 4.16E-02 9.45E-02
Prostate cancer 2C82 Prostate 3.43E-02 4.65E-02 2.06E-01
Psoriasis EA90 Skin 2.17E-01 1.06E-02 5.45E-02
Rectal cancer 2B92 Rectal colon tissue 9.33E-01 -3.41E-02 -3.51E-01
Renal cancer 2C90-2C91 Kidney 2.04E-01 7.08E-02 4.39E-01
Retinoblastoma 2D02.2 Uvea 7.28E-05 1.77E-01 1.73E+00
Schizophrenia 6A20 Prefrontal cortex 7.51E-02 -3.11E-02 -3.01E-01
Schizophrenia 6A20 Superior temporal cortex 6.50E-01 -1.35E-02 -1.86E-01
Scleroderma 4A42.Z Whole blood 3.54E-02 1.21E-01 9.29E-01
Seizure 8A60-8A6Z Whole blood 2.56E-01 2.74E-02 2.37E-01
Sepsis with septic shock 1G41 Whole blood 3.94E-02 -2.14E-02 -1.37E-01
Sickle cell disease 3A51.0-3A51.3 Peripheral blood 1.27E-01 2.77E-02 2.94E-01
Simpson golabi behmel syndrome LD2C Adipose tissue 5.73E-01 7.12E-02 5.45E-01
Sjogren's syndrome 4A43.2 Salivary gland tissue 4.23E-01 -1.41E-02 -1.57E-01
Skin cancer 2C30-2C3Z Skin 7.25E-13 9.86E-02 4.28E-01
Thrombocythemia 3B63 Whole blood 5.03E-01 2.32E-03 2.58E-02
Thrombocytopenia 3B64 Whole blood 9.84E-01 -4.65E-02 -3.35E-01
Thyroid cancer 2D10 Thyroid 1.24E-03 -6.10E-02 -3.81E-01
Tibial muscular dystrophy 8C75 Muscle tissue 2.64E-01 -4.21E-03 -3.95E-02
Tuberous sclerosis complex LD2D.2 Perituberal tissue 7.70E-01 -5.35E-03 -3.16E-02
Type 2 diabetes 5A11 Liver tissue 9.79E-01 -7.86E-01 -3.93E-01
Ureter cancer 2C92 Urothelium 2.29E-01 -2.22E-02 -1.84E-01
Uterine cancer 2C78 Endometrium tissue 1.24E-04 3.77E-02 2.99E-01
Vitiligo ED63.0 Skin 5.00E-01 -1.80E-01 -5.60E-01
------------------------------------------------------------------------------------
⏷ Show the Full List of DME Expression Under 61 Diseases

References

1 Cholesterol-metabolizing cytochromes P450. Drug Metab Dispos. 2006 Apr;34(4):513-20.
2 FGF15 activates Hippo signaling to suppress bile acid metabolism and liver tumorigenesis. Dev Cell. 2019 Feb 25;48(4):460-474.e9.