Details of Drug-Metabolizing Enzyme (DME)
General Information of Drug-Metabolizing Enzyme (DME) (ID: DEEBFXM)
DME Name | Dihydrofolate reductase (folA) | ||||
---|---|---|---|---|---|
Synonyms | DHF reductase; 5,6,7,8-tetrahydrofolate: NADP+ oxidoreductase; Bifunctional TS-DHFR; BmDHFR; Bacterial DFR-TS; Bacterial DHFR; TC_0902; folA | ||||
Gene Name | folA | ||||
UniProt ID | |||||
INTEDE ID | |||||
3D Structure | |||||
EC Number | EC: 1.5.1.3 | ||||
Lineage | Species: Lactobacillus casei | ||||
Tissue Distribution | Primarily distributed in human gut. | ||||
Sequence |
MTAFLWAQDRDGLIGKDGHLPWHLPDDLHYFRAQTVGKIMVVGRRTYESFPKRPLPERTN
VVLTHQEDYQAQGAVVVHDVAAVFAYAKQHPDQELVIAGGAQIFTAFKDDVDTLLVTRLA GSFEGDTKMIPLNWDDFTKVSSRTVEDTNPALTHTYEVWQKKA |
||||
Function |
This enzyme is key enzyme in folate metabolism and can catalyze an essential reaction for de novo glycine and purine synthesis, and for DNA precursor synthesis. And it also slowly reduces folate to 5,6,7,8-tetrahydrofolate.
|
||||
Molecular Interaction Atlas (MIA) of This DME
Molecular Interaction Atlas (MIA) | ||||||||||||||||||||||||||||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
1 Approved Drug(s) Metabolized by This DME
|
||||||||||||||||||||||||||||