Details of Drug-Metabolizing Enzyme (DME)

General Information of Drug-Metabolizing Enzyme (DME) (ID: DEEGA13)

DME Name Telethon sulfatase (ARSK)
Synonyms Arylsulfatase K; Aryl-sulfate sulphohydrolase K; 4-methylumbelliferyl sulfatase K; ARSK; ASK; TSULF; UNQ630/PRO1246
Gene Name ARSK
UniProt ID
ARSK_HUMAN
INTEDE ID
DME0510
3D Structure
Download
2D Sequence (FASTA)
Download
3D Structure (PDB)
Download
Gene ID
153642
EC Number EC: 3.1.6.1
Hydrolases
Ester bond hydrolase
Sulfuric ester hydrolase
EC: 3.1.6.1
Lineage Species: Homo sapiens
Kingdom: Metazoa
Phylum: Chordata
Class: Mammalia
Order: Primates
Family: Hominidae
Genus: Homo
Species: Homo sapiens
Sequence
MLLLWVSVVAALALAVLAPGAGEQRRRAAKAPNVVLVVSDSFDGRLTFHPGSQVVKLPFI
NFMKTRGTSFLNAYTNSPICCPSRAAMWSGLFTHLTESWNNFKGLDPNYTTWMDVMERHG
YRTQKFGKLDYTSGHHSISNRVEAWTRDVAFLLRQEGRPMVNLIRNRTKVRVMERDWQNT
DKAVNWLRKEAINYTEPFVIYLGLNLPHPYPSPSSGENFGSSTFHTSLYWLEKVSHDAIK
IPKWSPLSEMHPVDYYSSYTKNCTGRFTKKEIKNIRAFYYAMCAETDAMLGEIILALHQL
DLLQKTIVIYSSDHGELAMEHRQFYKMSMYEASAHVPLLMMGPGIKAGLQVSNVVSLVDI
YPTMLDIAGIPLPQNLSGYSLLPLSSETFKNEHKVKNLHPPWILSEFHGCNVNASTYMLR
TNHWKYIAYSDGASILPQLFDLSSDPDELTNVAVKFPEITYSLDQKLHSIINYPKVSASV
HQYNKEQFIKWKQSIGQNYSNVIANLRWHQDWQKEPRKYENAIDQWLKTHMNPRAV
Function
This enzyme acts selectively on 2-sulfoglucuronate and lacks activity against 2-sulfoiduronate, whereas iduronate-2-sulfatase (IDS) desulfates synthetic disaccharides containing 2-sulfoiduronate but not 2-sulfoglucuronate.
Reactome Pathway
The activation of arylsulfatases (R-HSA-1663150 )
Glycosphingolipid metabolism (R-HSA-1660662 )

Molecular Interaction Atlas (MIA) of This DME

Molecular Interaction Atlas (MIA) Jump to Detail Molecular Interaction Atlas of This DME
1 Investigative Drug(s) Metabolized by This DME
Drug Name Drug ID Indication ICD 11 Highest Status REF
Nitrocatechol sulfate DMGUNIL N. A. N. A. Investigative [1]

Molecular Expression Atlas (MEA) of This DME

Molecular Expression Atlas (MEA) Jump to Detail Molecular Expression Atlas of This DME
Disease Name ICD 11 Studied Tissue p-value Fold-Change Z-score
Acute myelocytic leukaemia 2B33.1 Bone marrow 3.20E-04 1.03E-01 4.25E-01
Alopecia ED70 Skin from scalp 1.12E-01 -1.30E-01 -4.02E-01
Alzheimer's disease 8A20 Entorhinal cortex 2.54E-02 1.01E-01 3.57E-01
Ankylosing spondylitis FA92.0 Pheripheral blood 7.79E-01 2.69E-02 6.99E-02
Aortic stenosis BB70 Calcified aortic valve 5.55E-01 -8.70E-02 -2.52E-01
Apnea 7A40 Hyperplastic tonsil 6.60E-01 3.59E-02 2.22E-01
Arthropathy FA00-FA5Z Peripheral blood 6.67E-01 7.57E-02 1.48E-01
Asthma CA23 Nasal and bronchial airway 3.30E-02 -1.23E-01 -3.42E-01
Atopic dermatitis EA80 Skin 6.45E-04 -1.48E-01 -6.89E-01
Autism 6A02 Whole blood 9.33E-01 -6.28E-02 -2.26E-01
Autoimmune uveitis 9A96 Peripheral monocyte 1.93E-02 -1.26E-01 -6.62E-01
Autosomal dominant monocytopenia 4B04 Whole blood 1.67E-02 1.17E-01 7.81E-01
Bacterial infection of gingival 1C1H Gingival tissue 5.40E-11 -4.26E-01 -1.23E+00
Batten disease 5C56.1 Whole blood 1.42E-01 -7.75E-03 -2.00E-01
Behcet's disease 4A62 Peripheral blood 6.32E-01 -1.21E-01 -2.43E-01
Bipolar disorder 6A60-6A6Z Prefrontal cortex 2.59E-01 -3.43E-02 -2.50E-01
Bladder cancer 2C94 Bladder tissue 4.43E-01 -6.46E-02 -2.09E-01
Breast cancer 2C60-2C6Z Breast tissue 8.37E-32 -2.77E-01 -4.09E-01
Cardioembolic stroke 8B11.20 Whole blood 3.73E-01 -1.06E-01 -3.29E-01
Cervical cancer 2C77 Cervical tissue 1.99E-01 4.68E-01 6.00E-01
Childhood onset rheumatic disease FA20.Z Peripheral blood 4.56E-01 6.64E-02 1.14E-01
Chronic hepatitis C 1E51.1 Whole blood 8.22E-01 -7.08E-02 -3.33E-01
Chronic obstructive pulmonary disease CA22 Lung tissue 3.92E-01 -1.37E-01 -2.84E-01
Chronic obstructive pulmonary disease CA22 Small airway epithelium 8.00E-01 -2.80E-02 -9.56E-02
Chronic rhinosinusitis CA0A Sinus mucosa tissue 4.63E-01 2.35E-01 4.86E-01
Colon cancer 2B90 Colon tissue 9.97E-05 -1.84E-01 -4.09E-01
Coronary artery disease BA80-BA8Z Peripheral blood 2.73E-01 2.82E-02 2.08E-01
Diffuse large B-cell lymphoma 2A81 Tonsil tissue 4.32E-01 -1.00E-01 -3.45E-01
Endometriosis GA10 Endometrium tissue 6.11E-01 2.38E-01 6.12E-01
Familial hypercholesterolemia 5C80.00 Peripheral blood 1.69E-01 -2.05E-02 -1.32E-01
Familial hypercholesterolemia 5C80.00 Whole blood 6.51E-01 -1.41E-01 -4.49E-01
Gastric cancer 2B72 Gastric tissue 7.27E-01 -4.74E-02 -3.84E-02
Glioblastopma 2A00.00 Nervous tissue 1.21E-48 -2.59E-01 -6.83E-01
Glioma 2A00.0Y-2A00.0Z Brain stem tissue 6.67E-01 6.23E-02 2.55E-01
Glioma 2A00.0Y-2A00.0Z White matter tissue 2.68E-01 1.04E-01 1.84E-01
Head and neck cancer 2D42 Head and neck tissue 3.06E-04 3.45E-01 8.15E-01
HIV-associated neurocognitive impairment 8A2Y-8A2Z White matter tissue 4.54E-01 2.23E-01 5.28E-01
Huntington's disease 8A01.10 Whole blood 4.50E-01 5.85E-02 1.36E-01
Idiopathic pulmonary fibrosis CB03.4 Lung tissue 8.22E-04 -3.41E-01 -3.40E+00
Immunodeficiency 4A00-4A20 Peripheral blood 6.56E-03 -1.34E-01 -2.25E+00
Influenza 1E30 Whole blood 2.78E-01 1.53E-01 4.13E-01
Interstitial cystitis GC00.3 Bladder tissue 2.64E-02 -3.94E-01 -1.67E+00
Intracranial aneurysm 8B01.0 Intracranial artery 2.96E-01 -2.04E-02 -1.20E-01
Irritable bowel syndrome DD91.0 Rectal colon tissue 1.76E-01 -5.18E-02 -2.09E-01
Ischemic stroke 8B11 Peripheral blood 5.28E-01 -3.02E-02 -8.80E-02
Juvenile idiopathic arthritis FA24 Peripheral blood 4.82E-01 -6.74E-02 -1.86E-01
Lateral sclerosis 8B60.4 Skin 3.05E-01 1.38E-01 1.13E+00
Lateral sclerosis 8B60.4 Cervical spinal cord 9.80E-01 7.00E-02 2.82E-01
Liver cancer 2C12.0 Liver tissue 9.34E-03 3.89E-01 7.20E-01
Liver failure DB99.7-DB99.8 Liver tissue 8.12E-01 -1.13E-01 -2.86E-01
Lung cancer 2C25 Lung tissue 3.09E-09 -8.71E-02 -3.62E-01
Lupus erythematosus 4A40 Whole blood 5.17E-03 -1.86E-01 -4.38E-01
Major depressive disorder 6A70-6A7Z Hippocampus 4.94E-01 -1.85E-03 -1.36E-02
Major depressive disorder 6A70-6A7Z Whole blood 1.49E-01 -6.30E-02 -2.60E-01
Melanoma 2C30 Skin 5.11E-02 1.50E-01 2.01E-01
Multiple myeloma 2A83.1 Peripheral blood 2.24E-02 -2.81E-01 -1.11E+00
Multiple myeloma 2A83.1 Bone marrow 7.38E-04 8.43E-01 2.15E+00
Multiple sclerosis 8A40 Plasmacytoid dendritic cells 3.26E-01 1.63E-01 4.92E-01
Myelodysplastic syndrome 2A36-2A3Z Bone marrow 8.97E-01 -4.43E-03 -2.12E-02
Myelofibrosis 2A20.2 Whole blood 4.97E-03 -5.79E-02 -3.19E-01
Myocardial infarction BA41-BA50 Peripheral blood 7.75E-01 1.88E-01 2.11E-01
Myopathy 8C70.6 Muscle tissue 8.05E-01 3.12E-02 1.47E-01
Neonatal sepsis KA60 Whole blood 2.44E-17 -8.29E-01 -2.01E+00
Neuroectodermal tumour 2A00.11 Brain stem tissue 9.13E-01 -4.25E-02 -1.12E-01
Non-alcoholic fatty liver disease DB92 Liver tissue 6.94E-01 -2.06E-01 -1.89E+00
Obesity related type 2 diabetes 5A11 Omental adipose tissue 1.55E-01 3.86E-02 3.68E-01
Olive pollen allergy CA08.00 Peripheral blood 4.55E-01 4.42E-02 3.65E-01
Oral cancer 2B6E Oral tissue 4.86E-02 1.63E-01 2.32E-01
Osteoarthritis FA00-FA0Z Synovial tissue 6.84E-01 9.63E-02 2.24E-01
Osteoporosis FB83.1 Bone marrow 6.54E-01 -2.35E-03 -2.96E-02
Ovarian cancer 2C73 Ovarian tissue 1.25E-01 -2.31E-01 -2.92E-01
Pancreatic cancer 2C10 Pancreas 2.79E-01 -1.07E-01 -2.99E-01
Parkinson's disease 8A00.0 Substantia nigra tissue 1.72E-01 3.97E-01 1.45E+00
Pediatric respiratory syncytial virus infection CA40.11 Peripheral blood 5.44E-04 -4.05E-01 -1.46E+00
Pituitary cancer 2D12 Pituitary tissue 1.62E-02 -2.50E-01 -4.99E-01
Pituitary gonadotrope tumour 2D12 Pituitary tissue 2.36E-03 -2.15E-01 -9.64E-01
Polycystic ovary syndrome 5A80.1 Vastus lateralis muscle 5.48E-01 7.70E-03 6.58E-02
Polycythemia vera 2A20.4 Whole blood 9.31E-13 -3.27E-01 -1.66E+00
Pompe disease 5C51.3 Biceps muscle 9.19E-01 2.22E-02 1.07E-01
Preterm birth KA21.4Z Myometrium 7.42E-01 -1.30E-01 -5.29E-01
Prostate cancer 2C82 Prostate 1.23E-03 -6.20E-01 -7.67E-01
Psoriasis EA90 Skin 7.76E-18 -3.55E-01 -1.06E+00
Rectal cancer 2B92 Rectal colon tissue 2.64E-02 -2.32E-01 -8.41E-01
Renal cancer 2C90-2C91 Kidney 4.11E-01 -1.09E-01 -1.49E-01
Retinoblastoma 2D02.2 Uvea 1.90E-03 -4.51E-01 -4.07E+00
Rheumatoid arthritis FA20 Synovial tissue 2.29E-02 4.47E-01 1.47E+00
Rhinovirus infection CA42.1 Nasal epithelium tissue 3.98E-02 7.75E-02 4.07E-01
Schizophrenia 6A20 Prefrontal cortex 4.20E-01 1.30E-01 3.81E-01
Schizophrenia 6A20 Superior temporal cortex 4.82E-01 8.93E-02 3.47E-01
Scleroderma 4A42.Z Whole blood 6.04E-01 -1.03E-02 -4.89E-02
Seizure 8A60-8A6Z Whole blood 7.40E-01 8.91E-03 4.51E-02
Sensitive skin EK0Z Skin 6.47E-01 2.02E-01 4.65E-01
Sepsis with septic shock 1G41 Whole blood 5.90E-19 -5.20E-01 -1.29E+00
Shwachman-Diamond syndrome 3A70.0 Bone marrow 4.54E-01 2.07E-01 5.25E-01
Sickle cell disease 3A51.0-3A51.3 Peripheral blood 9.54E-01 -6.90E-02 -1.82E-01
Simpson golabi behmel syndrome LD2C Adipose tissue 5.11E-01 -1.43E-02 -1.04E-01
Sjogren's syndrome 4A43.2 Salivary gland tissue 1.20E-01 -6.39E-01 -2.30E+00
Skin cancer 2C30-2C3Z Skin 4.79E-05 -2.97E-01 -5.29E-01
Thrombocythemia 3B63 Whole blood 2.30E-03 -1.03E-01 -5.35E-01
Thrombocytopenia 3B64 Whole blood 1.06E-01 2.87E-01 4.46E-01
Thyroid cancer 2D10 Thyroid 7.55E-03 -5.05E-02 -2.00E-01
Tibial muscular dystrophy 8C75 Muscle tissue 4.15E-02 -5.74E-01 -1.11E+00
Tuberous sclerosis complex LD2D.2 Perituberal tissue 2.10E-02 1.95E-01 1.70E+00
Type 2 diabetes 5A11 Liver tissue 1.62E-01 3.68E-01 7.83E-01
Ureter cancer 2C92 Urothelium 3.35E-01 4.47E-02 1.79E-01
Uterine cancer 2C78 Endometrium tissue 1.21E-04 3.37E-01 5.34E-01
Vitiligo ED63.0 Skin 2.97E-02 2.82E-01 1.47E+00
------------------------------------------------------------------------------------
⏷ Show the Full List of DME Expression Under 107 Diseases

References

1 Arylsulfatase K, a novel lysosomal sulfatase. J Biol Chem. 2013 Oct 18;288(42):30019-28.