Details of Drug-Metabolizing Enzyme (DME)

General Information of Drug-Metabolizing Enzyme (DME) (ID: DEEH5Y9)

DME Name Methionine-tRNA ligase mitochondrial (MARS2)
Synonyms Methionyl-tRNA synthetase 2; Mitochondrial methionyl-tRNA synthetase; Methionine--tRNA ligase mitochondrial; MtMetRS; MARS2
Gene Name MARS2
UniProt ID
SYMM_HUMAN
INTEDE ID
DME0187
3D Structure
Download
2D Sequence (FASTA)
Download
3D Structure (PDB)
Download
Gene ID
92935
EC Number EC: 6.1.1.10
Ligase
Carbon-oxygen ligase
Aminoacyl tRNA synthetase
EC: 6.1.1.10
Lineage Species: Homo sapiens
Kingdom: Metazoa
Phylum: Chordata
Class: Mammalia
Order: Primates
Family: Hominidae
Genus: Homo
Species: Homo sapiens
Sequence
MLRTSVLRLLGRTGASRLSLLEDFGPRYYSSGSLSAGDDACDVRAYFTTPIFYVNAAPHI
GHLYSALLADALCRHRRLRGPSTAATRFSTGTDEHGLKIQQAAATAGLAPTELCDRVSEQ
FQQLFQEAGISCTDFIRTTEARHRVAVQHFWGVLKSRGLLYKGVYEGWYCASDECFLPEA
KVTQQPGPSGDSFPVSLESGHPVSWTKEENYIFRLSQFRKPLQRWLRGNPQAITPEPFHH
VVLQWLDEELPDLSVSRRSSHLHWGIPVPGDDSQTIYVWLDALVNYLTVIGYPNAEFKSW
WPATSHIIGKDILKFHAIYWPAFLLGAGMSPPQRICVHSHWTVCGQKMSKSLGNVVDPRT
CLNRYTVDGFRYFLLRQGVPNWDCDYYDEKVVKLLNSELADALGGLLNRCTAKRINPSET
YPAFCTTCFPSEPGLVGPSVRAQAEDYALVSAVATLPKQVADHYDNFRIYKALEAVSSCV
RQTNGFVQRHAPWKLNWESPVDAPWLGTVLHVALECLRVFGTLLQPVTPSLADKLLSRLG
VSASERSLGELYFLPRFYGHPCPFEGRRLGPETGLLFPRLDQSRTWLVKAHRT
Function This enzyme participates in 3 metabolic pathways: methionine metabolism, selenoamino acid metabolism, and aminoacyl-trna biosynthesis.
KEGG Pathway
Aminoacyl-tRNA biosynthesis (hsa00970 )
Metabolic pathways (hsa01100 )
Selenocompound metabolism (hsa00450 )
Reactome Pathway
Mitochondrial tRNA aminoacylation (R-HSA-379726 )

Molecular Interaction Atlas (MIA) of This DME

Molecular Interaction Atlas (MIA) Jump to Detail Molecular Interaction Atlas of This DME
1 Investigative Drug(s) Metabolized by This DME
Drug Name Drug ID Indication ICD 11 Highest Status REF
L-methionine DME8G1U Discovery agent N.A. Investigative [1]

Molecular Expression Atlas (MEA) of This DME

Molecular Expression Atlas (MEA) Jump to Detail Molecular Expression Atlas of This DME
Disease Name ICD 11 Studied Tissue p-value Fold-Change Z-score
Acute myelocytic leukaemia 2B33.1 Bone marrow 3.42E-06 1.61E-01 5.42E-01
Alopecia ED70 Skin from scalp 4.45E-02 2.53E-01 4.18E-01
Alzheimer's disease 8A20 Entorhinal cortex 8.06E-05 -1.28E-01 -5.28E-01
Ankylosing spondylitis FA92.0 Pheripheral blood 8.19E-02 2.98E-01 1.13E+00
Aortic stenosis BB70 Calcified aortic valve 9.34E-01 -9.26E-02 -2.57E-01
Apnea 7A40 Hyperplastic tonsil 6.09E-01 1.30E-01 2.96E-01
Arthropathy FA00-FA5Z Peripheral blood 5.52E-03 -1.71E-01 -6.77E-01
Asthma CA23 Nasal and bronchial airway 2.65E-05 -2.35E-01 -2.87E-01
Atopic dermatitis EA80 Skin 3.88E-01 -6.88E-03 -2.19E-02
Autism 6A02 Whole blood 3.44E-02 -2.09E-01 -7.13E-01
Autoimmune uveitis 9A96 Peripheral monocyte 2.92E-02 -1.85E-01 -6.23E-01
Autosomal dominant monocytopenia 4B04 Whole blood 7.92E-01 5.80E-03 3.01E-02
Bacterial infection of gingival 1C1H Gingival tissue 3.52E-01 1.88E-02 5.62E-02
Batten disease 5C56.1 Whole blood 4.04E-01 -5.47E-01 -1.48E+00
Behcet's disease 4A62 Peripheral blood 4.45E-01 -4.12E-02 -1.31E-01
Bipolar disorder 6A60-6A6Z Prefrontal cortex 5.29E-01 -2.62E-02 -1.11E-01
Bladder cancer 2C94 Bladder tissue 9.69E-04 3.37E-01 1.48E+00
Breast cancer 2C60-2C6Z Breast tissue 1.47E-03 3.21E-02 6.89E-02
Cardioembolic stroke 8B11.20 Whole blood 1.17E-02 -1.96E-01 -5.37E-01
Cervical cancer 2C77 Cervical tissue 6.83E-01 6.56E-02 1.49E-01
Childhood onset rheumatic disease FA20.Z Peripheral blood 5.74E-02 3.13E-01 5.39E-01
Chronic hepatitis C 1E51.1 Whole blood 1.45E-01 -1.32E-01 -7.10E-01
Chronic obstructive pulmonary disease CA22 Lung tissue 5.90E-02 8.56E-02 3.96E-01
Chronic obstructive pulmonary disease CA22 Small airway epithelium 8.59E-06 -2.08E-01 -6.12E-01
Chronic rhinosinusitis CA0A Sinus mucosa tissue 5.08E-01 5.64E-02 2.76E-01
Colon cancer 2B90 Colon tissue 5.38E-20 4.94E-01 9.09E-01
Coronary artery disease BA80-BA8Z Peripheral blood 8.25E-01 3.72E-02 4.08E-01
Diffuse large B-cell lymphoma 2A81 Tonsil tissue 2.73E-01 3.98E-01 5.66E-01
Endometriosis GA10 Endometrium tissue 2.38E-01 -1.37E-01 -2.01E-01
Familial hypercholesterolemia 5C80.00 Peripheral blood 6.57E-01 2.08E-02 9.83E-02
Familial hypercholesterolemia 5C80.00 Whole blood 6.88E-04 -3.34E-01 -9.88E-01
Gastric cancer 2B72 Gastric tissue 6.82E-02 3.73E-01 1.40E+00
Glioblastopma 2A00.00 Nervous tissue 3.28E-04 8.12E-02 2.09E-01
Glioma 2A00.0Y-2A00.0Z Brain stem tissue 3.77E-01 4.35E-01 9.38E-01
Glioma 2A00.0Y-2A00.0Z White matter tissue 2.67E-03 8.29E-01 1.22E+00
Head and neck cancer 2D42 Head and neck tissue 1.53E-05 -2.41E-01 -7.21E-01
HIV-associated neurocognitive impairment 8A2Y-8A2Z White matter tissue 1.36E-03 -1.98E-01 -8.78E-01
Huntington's disease 8A01.10 Whole blood 2.47E-01 -1.07E-01 -5.83E-01
Idiopathic pulmonary fibrosis CB03.4 Lung tissue 6.92E-01 2.65E-02 4.23E-02
Immunodeficiency 4A00-4A20 Peripheral blood 8.45E-01 -1.17E-01 -4.02E-01
Influenza 1E30 Whole blood 1.45E-03 -1.19E+00 -5.22E+00
Interstitial cystitis GC00.3 Bladder tissue 4.65E-01 0.00E+00 0.00E+00
Intracranial aneurysm 8B01.0 Intracranial artery 6.16E-01 -3.60E-02 -1.01E-01
Irritable bowel syndrome DD91.0 Rectal colon tissue 4.39E-02 -1.36E-01 -2.75E-01
Ischemic stroke 8B11 Peripheral blood 3.65E-01 -1.45E-01 -4.47E-01
Juvenile idiopathic arthritis FA24 Peripheral blood 4.94E-01 -2.27E-01 -3.26E-01
Lateral sclerosis 8B60.4 Skin 2.33E-02 3.58E-01 1.85E+00
Lateral sclerosis 8B60.4 Cervical spinal cord 6.80E-01 5.89E-02 1.33E-01
Liver cancer 2C12.0 Liver tissue 2.25E-02 1.99E-01 3.75E-01
Liver failure DB99.7-DB99.8 Liver tissue 9.46E-04 -5.88E-01 -1.61E+00
Lung cancer 2C25 Lung tissue 1.37E-45 5.61E-01 1.35E+00
Lupus erythematosus 4A40 Whole blood 3.18E-03 -1.58E-01 -4.46E-01
Major depressive disorder 6A70-6A7Z Hippocampus 3.02E-01 -3.81E-02 -1.66E-01
Major depressive disorder 6A70-6A7Z Whole blood 5.69E-01 -4.15E-02 -1.04E-01
Melanoma 2C30 Skin 3.67E-02 3.29E-01 3.92E-01
Multiple myeloma 2A83.1 Peripheral blood 5.96E-02 2.35E-01 1.06E+00
Multiple myeloma 2A83.1 Bone marrow 6.28E-01 -1.05E-01 -2.41E-01
Multiple sclerosis 8A40 Plasmacytoid dendritic cells 7.53E-01 7.34E-02 2.60E-01
Myelodysplastic syndrome 2A36-2A3Z Bone marrow 2.58E-01 1.39E-01 2.02E-01
Myelofibrosis 2A20.2 Whole blood 6.31E-04 1.41E-01 8.11E-01
Myocardial infarction BA41-BA50 Peripheral blood 7.99E-05 -3.84E-01 -4.16E-01
Myopathy 8C70.6 Muscle tissue 8.40E-01 -1.50E-01 -2.30E-01
Neonatal sepsis KA60 Whole blood 2.27E-06 -1.73E-01 -5.43E-01
Neuroectodermal tumour 2A00.11 Brain stem tissue 5.28E-01 -1.22E-02 -6.84E-02
Non-alcoholic fatty liver disease DB92 Liver tissue 5.52E-01 -5.20E-02 -1.88E-01
Obesity related type 2 diabetes 5A11 Omental adipose tissue 5.64E-01 -3.41E-01 -4.15E-01
Olive pollen allergy CA08.00 Peripheral blood 5.14E-01 1.07E-01 2.82E-01
Oral cancer 2B6E Oral tissue 6.05E-01 -2.10E-01 -5.20E-01
Osteoarthritis FA00-FA0Z Synovial tissue 2.79E-01 2.78E-01 6.17E-01
Osteoporosis FB83.1 Bone marrow 7.41E-01 7.32E-02 2.67E-01
Ovarian cancer 2C73 Ovarian tissue 2.02E-03 7.68E-01 1.70E+00
Pancreatic cancer 2C10 Pancreas 1.61E-02 -3.66E-01 -7.06E-01
Parkinson's disease 8A00.0 Substantia nigra tissue 1.91E-01 1.72E-01 5.56E-01
Pediatric respiratory syncytial virus infection CA40.11 Peripheral blood 3.75E-01 -5.24E-03 -1.99E-02
Pituitary cancer 2D12 Pituitary tissue 3.59E-01 1.78E-01 4.62E-01
Pituitary gonadotrope tumour 2D12 Pituitary tissue 7.35E-01 5.76E-02 1.27E-01
Polycystic ovary syndrome 5A80.1 Vastus lateralis muscle 5.47E-01 7.33E-02 3.60E-01
Polycythemia vera 2A20.4 Whole blood 2.73E-07 2.29E-01 1.29E+00
Pompe disease 5C51.3 Biceps muscle 3.58E-03 -4.50E-01 -1.19E+00
Preterm birth KA21.4Z Myometrium 3.84E-01 -3.60E-02 -3.80E-01
Prostate cancer 2C82 Prostate 1.38E-05 4.61E-01 9.81E-01
Psoriasis EA90 Skin 1.78E-02 8.68E-02 2.57E-01
Rectal cancer 2B92 Rectal colon tissue 5.63E-03 5.40E-01 1.93E+00
Renal cancer 2C90-2C91 Kidney 1.35E-02 -3.32E-01 -1.60E+00
Retinoblastoma 2D02.2 Uvea 6.87E-07 1.10E+00 3.54E+00
Rheumatoid arthritis FA20 Synovial tissue 5.88E-05 7.01E-01 3.41E+00
Rhinovirus infection CA42.1 Nasal epithelium tissue 6.82E-01 1.99E-02 1.24E-01
Schizophrenia 6A20 Prefrontal cortex 9.45E-01 1.10E-01 2.76E-01
Schizophrenia 6A20 Superior temporal cortex 5.12E-01 -4.46E-02 -2.55E-01
Scleroderma 4A42.Z Whole blood 1.26E-01 -1.80E-01 -6.71E-01
Seizure 8A60-8A6Z Whole blood 1.52E-01 -2.02E-02 -4.95E-02
Sensitive skin EK0Z Skin 5.01E-01 3.01E-01 1.14E+00
Sepsis with septic shock 1G41 Whole blood 8.74E-28 -3.67E-01 -1.32E+00
Shwachman-Diamond syndrome 3A70.0 Bone marrow 2.69E-01 2.88E-01 7.69E-01
Sickle cell disease 3A51.0-3A51.3 Peripheral blood 4.58E-01 -5.89E-02 -4.36E-01
Simpson golabi behmel syndrome LD2C Adipose tissue 1.12E-01 -1.02E+00 -2.02E+00
Sjogren's syndrome 4A43.2 Salivary gland tissue 7.30E-01 2.01E-01 5.04E-01
Skin cancer 2C30-2C3Z Skin 1.98E-27 4.76E-01 1.08E+00
Thrombocythemia 3B63 Whole blood 5.15E-02 1.48E-01 8.23E-01
Thrombocytopenia 3B64 Whole blood 5.16E-01 -1.46E-01 -2.57E-01
Thyroid cancer 2D10 Thyroid 5.14E-01 -1.07E-01 -3.23E-01
Tibial muscular dystrophy 8C75 Muscle tissue 1.46E-01 -1.68E-01 -4.76E-01
Tuberous sclerosis complex LD2D.2 Perituberal tissue 1.75E-02 -3.80E-01 -3.21E+00
Type 2 diabetes 5A11 Liver tissue 9.62E-01 9.15E-02 2.33E-01
Ureter cancer 2C92 Urothelium 2.27E-01 -6.01E-02 -2.31E-01
Uterine cancer 2C78 Endometrium tissue 8.16E-01 -1.05E-01 -2.21E-01
Vitiligo ED63.0 Skin 9.61E-01 1.56E-01 3.94E-01
------------------------------------------------------------------------------------
⏷ Show the Full List of DME Expression Under 107 Diseases

References

1 How many drug targets are there? Nat Rev Drug Discov. 2006 Dec;5(12):993-6.