Details of Drug-Metabolizing Enzyme (DME)

General Information of Drug-Metabolizing Enzyme (DME) (ID: DEEY674)

DME Name PFK/FBPase 3 (PFKFB3)
Synonyms
Fructose-2,6-bisphosphatase; Renal carcinoma antigen NY-REN-56; 6-phosphofructo-2-kinase; 6-phosphofructo-2-kinase/fructose-2,6-bisphosphatase 3; 6PF-2-K/Fru-2,6-P2ase 3; 6PF-2-K/Fru-2,6-P2ase brain/placenta-type isozyme; PFKFB3; iPFK-2
Gene Name PFKFB3
UniProt ID
F263_HUMAN
INTEDE ID
DME0515
3D Structure
Download
2D Sequence (FASTA)
Download
3D Structure (PDB)
Download
Gene ID
5209
EC Number EC: 2.7.1.105
Transferase
Kinase
Phosphotransferase
EC: 2.7.1.105
Lineage Species: Homo sapiens
Kingdom: Metazoa
Phylum: Chordata
Class: Mammalia
Order: Primates
Family: Hominidae
Genus: Homo
Species: Homo sapiens
Sequence
MPLELTQSRVQKIWVPVDHRPSLPRSCGPKLTNSPTVIVMVGLPARGKTYISKKLTRYLN
WIGVPTKVFNVGEYRREAVKQYSSYNFFRPDNEEAMKVRKQCALAALRDVKSYLAKEGGQ
IAVFDATNTTRERRHMILHFAKENDFKAFFIESVCDDPTVVASNIMEVKISSPDYKDCNS
AEAMDDFMKRISCYEASYQPLDPDKCDRDLSLIKVIDVGRRFLVNRVQDHIQSRIVYYLM
NIHVQPRTIYLCRHGENEHNLQGRIGGDSGLSSRGKKFASALSKFVEEQNLKDLRVWTSQ
LKSTIQTAEALRLPYEQWKALNEIDAGVCEELTYEEIRDTYPEEYALREQDKYYYRYPTG
ESYQDLVQRLEPVIMELERQENVLVICHQAVLRCLLAYFLDKSAEEMPYLKCPLHTVLKL
TPVAYGCRVESIYLNVESVCTHRERSEDAKKGPNPLMRRNSVTPLASPEPTKKPRINSFE
EHVASTSAALPSCLPPEVPTQLPGQNMKGSRSSADSSRKH
Function This enzyme degrades fructose 2,6-bisphosphate.
KEGG Pathway
AMPK signaling pathway (hsa04152 )
Fructose and mannose metabolism (hsa00051 )
HIF-1 signaling pathway (hsa04066 )
Metabolic pathways (hsa01100 )
Reactome Pathway
Regulation of glycolysis by fructose 2,6-bisphosphate metabolism (R-HSA-9634600 )

Molecular Interaction Atlas (MIA) of This DME

Molecular Interaction Atlas (MIA) Jump to Detail Molecular Interaction Atlas of This DME
1 Investigative Drug(s) Metabolized by This DME
Drug Name Drug ID Indication ICD 11 Highest Status REF
Beta-fructose phosphate DM25QXM N. A. N. A. Investigative [3]

Molecular Expression Atlas (MEA) of This DME

Molecular Expression Atlas (MEA) Jump to Detail Molecular Expression Atlas of This DME
Disease Name ICD 11 Studied Tissue p-value Fold-Change Z-score
Acute myelocytic leukaemia 2B33.1 Bone marrow 3.44E-14 -8.06E-01 -9.23E-01
Alopecia ED70 Skin from scalp 5.53E-02 1.97E-02 9.88E-02
Alzheimer's disease 8A20 Entorhinal cortex 1.44E-08 3.63E-01 7.98E-01
Ankylosing spondylitis FA92.0 Pheripheral blood 3.34E-01 1.58E-01 3.42E-01
Aortic stenosis BB70 Calcified aortic valve 9.30E-01 -3.16E-01 -2.65E-01
Apnea 7A40 Hyperplastic tonsil 9.05E-01 1.04E-01 1.10E-01
Arthropathy FA00-FA5Z Peripheral blood 2.18E-02 3.29E-01 8.81E-01
Asthma CA23 Nasal and bronchial airway 4.56E-01 3.50E-01 3.53E-01
Atopic dermatitis EA80 Skin 7.51E-03 1.54E-01 2.61E-01
Autism 6A02 Whole blood 1.65E-01 1.93E-01 3.77E-01
Autoimmune uveitis 9A96 Peripheral monocyte 9.05E-01 1.73E-01 2.94E-01
Autosomal dominant monocytopenia 4B04 Whole blood 1.29E-01 1.40E+00 1.11E+00
Bacterial infection of gingival 1C1H Gingival tissue 2.64E-07 4.76E-01 7.90E-01
Batten disease 5C56.1 Whole blood 3.69E-01 -5.17E-02 -1.77E-01
Behcet's disease 4A62 Peripheral blood 4.05E-01 -1.19E-01 -9.69E-02
Bipolar disorder 6A60-6A6Z Prefrontal cortex 2.12E-01 9.02E-02 4.18E-01
Bladder cancer 2C94 Bladder tissue 7.70E-03 9.08E-01 1.76E+00
Breast cancer 2C60-2C6Z Breast tissue 1.81E-53 -1.17E+00 -1.18E+00
Cardioembolic stroke 8B11.20 Whole blood 3.26E-09 4.50E-01 1.92E+00
Cervical cancer 2C77 Cervical tissue 5.10E-03 -3.35E-01 -4.43E-01
Childhood onset rheumatic disease FA20.Z Peripheral blood 8.35E-01 -1.02E-01 -1.19E-01
Chronic hepatitis C 1E51.1 Whole blood 9.32E-01 -1.55E-01 -1.93E-01
Chronic obstructive pulmonary disease CA22 Lung tissue 2.84E-01 3.84E-02 6.45E-02
Chronic obstructive pulmonary disease CA22 Small airway epithelium 2.89E-03 1.75E-01 4.27E-01
Chronic rhinosinusitis CA0A Sinus mucosa tissue 5.76E-02 -6.05E-01 -9.85E-01
Colon cancer 2B90 Colon tissue 8.26E-70 1.40E+00 2.48E+00
Coronary artery disease BA80-BA8Z Peripheral blood 5.96E-01 3.38E-01 3.13E-01
Diffuse large B-cell lymphoma 2A81 Tonsil tissue 9.23E-01 -2.13E-01 -5.84E-01
Endometriosis GA10 Endometrium tissue 9.13E-01 -2.62E-01 -1.84E-01
Familial hypercholesterolemia 5C80.00 Peripheral blood 3.15E-01 1.02E-01 3.65E-01
Familial hypercholesterolemia 5C80.00 Whole blood 1.05E-01 -2.95E-01 -6.77E-01
Gastric cancer 2B72 Gastric tissue 4.57E-02 1.16E+00 3.10E+00
Glioblastopma 2A00.00 Nervous tissue 7.29E-26 6.65E-01 1.15E+00
Glioma 2A00.0Y-2A00.0Z Brain stem tissue 6.84E-01 6.11E-01 3.59E-01
Glioma 2A00.0Y-2A00.0Z White matter tissue 1.97E-04 -4.65E-01 -1.84E+00
Head and neck cancer 2D42 Head and neck tissue 2.53E-27 1.31E+00 2.01E+00
HIV-associated neurocognitive impairment 8A2Y-8A2Z White matter tissue 2.02E-03 4.77E-01 7.44E-01
Huntington's disease 8A01.10 Whole blood 2.50E-01 -6.58E-02 -1.06E-01
Idiopathic pulmonary fibrosis CB03.4 Lung tissue 2.54E-02 -1.21E+00 -1.43E+00
Immunodeficiency 4A00-4A20 Peripheral blood 1.10E-02 3.44E-01 3.26E+00
Influenza 1E30 Whole blood 1.72E-02 -8.08E-01 -6.43E+00
Interstitial cystitis GC00.3 Bladder tissue 4.50E-03 7.51E-01 2.15E+00
Intracranial aneurysm 8B01.0 Intracranial artery 4.92E-02 8.07E-01 9.67E-01
Irritable bowel syndrome DD91.0 Rectal colon tissue 8.93E-03 3.13E-01 6.99E-01
Ischemic stroke 8B11 Peripheral blood 2.37E-01 2.46E-02 1.74E-02
Juvenile idiopathic arthritis FA24 Peripheral blood 3.87E-15 3.95E-01 1.17E+00
Lateral sclerosis 8B60.4 Skin 5.98E-01 -1.34E-01 -2.81E-01
Lateral sclerosis 8B60.4 Cervical spinal cord 2.53E-01 8.96E-02 1.55E-01
Liver cancer 2C12.0 Liver tissue 1.41E-04 -5.74E-01 -7.12E-01
Liver failure DB99.7-DB99.8 Liver tissue 1.02E-03 2.55E+00 1.98E+00
Lung cancer 2C25 Lung tissue 1.61E-03 -5.50E-02 -1.02E-01
Lupus erythematosus 4A40 Whole blood 6.36E-03 4.74E-01 3.81E-01
Major depressive disorder 6A70-6A7Z Hippocampus 8.35E-01 -7.42E-03 -3.34E-02
Major depressive disorder 6A70-6A7Z Whole blood 5.12E-02 1.71E-01 4.90E-01
Melanoma 2C30 Skin 9.72E-02 -5.39E-01 -6.05E-01
Multiple myeloma 2A83.1 Peripheral blood 4.90E-01 -8.51E-02 -2.11E-01
Multiple myeloma 2A83.1 Bone marrow 5.35E-01 -1.07E-01 -1.41E-01
Multiple sclerosis 8A40 Plasmacytoid dendritic cells 2.00E-01 7.87E-02 1.80E-01
Myelodysplastic syndrome 2A36-2A3Z Bone marrow 3.69E-02 -4.94E-01 -4.76E-01
Myelofibrosis 2A20.2 Whole blood 1.84E-01 3.99E-01 1.09E+00
Myocardial infarction BA41-BA50 Peripheral blood 1.65E-02 1.11E+00 8.46E-01
Myopathy 8C70.6 Muscle tissue 6.36E-02 -6.70E-01 -6.19E-01
Neonatal sepsis KA60 Whole blood 4.85E-55 2.35E+00 3.73E+00
Neuroectodermal tumour 2A00.11 Brain stem tissue 4.88E-07 -1.13E+00 -2.88E+00
Non-alcoholic fatty liver disease DB92 Liver tissue 5.65E-02 1.07E+00 9.95E-01
Obesity related type 2 diabetes 5A11 Omental adipose tissue 6.98E-02 2.91E-01 1.09E+00
Olive pollen allergy CA08.00 Peripheral blood 1.82E-01 -1.00E+00 -1.16E+00
Oral cancer 2B6E Oral tissue 1.00E-04 8.82E-01 9.68E-01
Osteoarthritis FA00-FA0Z Synovial tissue 7.89E-02 -4.37E-01 -6.34E-01
Osteoporosis FB83.1 Bone marrow 8.25E-01 2.40E-01 3.64E-01
Ovarian cancer 2C73 Ovarian tissue 2.38E-01 4.03E-01 4.32E-01
Pancreatic cancer 2C10 Pancreas 6.79E-01 -2.80E-01 -2.42E-01
Parkinson's disease 8A00.0 Substantia nigra tissue 1.91E-01 2.85E-01 8.31E-01
Pediatric respiratory syncytial virus infection CA40.11 Peripheral blood 2.61E-04 1.54E+00 1.59E+00
Pituitary cancer 2D12 Pituitary tissue 9.63E-04 -9.76E-01 -1.33E+00
Pituitary gonadotrope tumour 2D12 Pituitary tissue 2.03E-04 -1.19E+00 -1.99E+00
Polycystic ovary syndrome 5A80.1 Vastus lateralis muscle 8.64E-01 -2.29E-01 -2.74E-01
Polycythemia vera 2A20.4 Whole blood 9.53E-18 1.03E+00 2.69E+00
Pompe disease 5C51.3 Biceps muscle 1.37E-02 -9.82E-01 -1.52E+00
Preterm birth KA21.4Z Myometrium 1.74E-01 -4.61E-01 -3.71E-01
Prostate cancer 2C82 Prostate 1.50E-02 1.85E+00 9.86E-01
Psoriasis EA90 Skin 1.91E-04 2.84E-01 3.74E-01
Rectal cancer 2B92 Rectal colon tissue 9.70E-04 1.21E+00 2.72E+00
Renal cancer 2C90-2C91 Kidney 3.35E-01 -8.80E-01 -6.07E-01
Retinoblastoma 2D02.2 Uvea 4.57E-05 1.44E+00 2.12E+00
Rheumatoid arthritis FA20 Synovial tissue 1.31E-03 -8.35E-01 -1.75E+00
Rhinovirus infection CA42.1 Nasal epithelium tissue 4.17E-03 2.41E-01 4.50E-01
Schizophrenia 6A20 Prefrontal cortex 9.26E-01 -4.05E-02 -6.91E-02
Schizophrenia 6A20 Superior temporal cortex 2.49E-01 2.72E-01 7.82E-01
Scleroderma 4A42.Z Whole blood 4.64E-01 -1.34E-01 -3.72E-01
Seizure 8A60-8A6Z Whole blood 9.81E-01 -1.12E-01 -1.10E-01
Sensitive skin EK0Z Skin 5.55E-02 -2.37E-01 -1.26E+00
Sepsis with septic shock 1G41 Whole blood 3.34E-120 2.89E+00 3.98E+00
Shwachman-Diamond syndrome 3A70.0 Bone marrow 5.72E-01 3.87E-02 4.94E-02
Sickle cell disease 3A51.0-3A51.3 Peripheral blood 5.34E-01 2.54E-01 4.97E-01
Simpson golabi behmel syndrome LD2C Adipose tissue 6.26E-02 7.87E-01 1.70E+00
Sjogren's syndrome 4A43.2 Salivary gland tissue 3.27E-02 8.37E-01 2.44E+00
Skin cancer 2C30-2C3Z Skin 7.81E-03 3.33E-01 3.63E-01
Thrombocythemia 3B63 Whole blood 1.96E-02 4.98E-02 1.34E-01
Thrombocytopenia 3B64 Whole blood 5.14E-01 5.54E-02 1.72E-01
Thyroid cancer 2D10 Thyroid 1.42E-13 1.03E+00 1.08E+00
Tibial muscular dystrophy 8C75 Muscle tissue 3.96E-01 -3.98E-01 -3.64E-01
Tuberous sclerosis complex LD2D.2 Perituberal tissue 7.09E-02 9.15E-01 7.08E+00
Type 2 diabetes 5A11 Liver tissue 1.82E-01 3.93E-01 5.80E-01
Ureter cancer 2C92 Urothelium 9.22E-01 2.71E-01 1.11E-01
Uterine cancer 2C78 Endometrium tissue 1.49E-06 8.29E-01 7.63E-01
Vitiligo ED63.0 Skin 6.85E-01 1.40E-02 9.87E-02
------------------------------------------------------------------------------------
⏷ Show the Full List of DME Expression Under 107 Diseases

The Drug Therapeutic Target (DTT) Role of This DME

DME DTT Name Renal carcinoma antigen NY-REN-56 (PFKFB3) DTT Info
DME DTT Type Clinical trial
1 Clinical Trial Drug(s) Targeting This DTT
Drug Name Drug ID Indication ICD 11 Highest Status REF
PFK-158 DMIR21F Solid tumour/cancer 2A00-2F9Z Phase 1 [1]
1 Investigative Drug(s) Targeting This DTT
Drug Name Drug ID Indication ICD 11 Highest Status REF
3PO DMPF5OX Pulmonary fibrosis CB03.4 Investigative [2]

References

1 Discovery of a PFKFB3 inhibitor for phase I trial testing that synergizes with the B-Raf inhibitor vemurafenib. Cancer Metab. 2014; 2(Suppl 1): P14.
2 CPEB4 Increases Expression of PFKFB3 to Induce Glycolysis and Activate Mouse and Human Hepatic Stellate Cells, Promoting Liver Fibrosis. Gastroenterology. 2020 Jul;159(1):273-288.
3 The kinase activity of human brain 6-phosphofructo-2-kinase/fructose-2,6-bisphosphatase is regulated via inhibition by phosphoenolpyruvate. Arch Biochem Biophys. 2005 Jun 15;438(2):125-36.