Details of Drug-Metabolizing Enzyme (DME)

General Information of Drug-Metabolizing Enzyme (DME) (ID: DEFJOAG)

DME Name Transglutaminase K (TGM1)
Synonyms Protein-glutamine gamma-glutamyltransferase K; Transglutaminase-1; Protein-glutamine gamma-glutamyltransferase 1; Epidermal TGase; TGase K; TGase-1; KTG; TG(K); TGK; TGM1
Gene Name TGM1
UniProt ID
TGM1_HUMAN
INTEDE ID
DME0166
3D Structure
Download
2D Sequence (FASTA)
Download
3D Structure (PDB)
Download
Gene ID
7051
EC Number EC: 2.3.2.13
Transferase
Acyltransferase
Aminoacyltransferase
EC: 2.3.2.13
Lineage Species: Homo sapiens
Kingdom: Metazoa
Phylum: Chordata
Class: Mammalia
Order: Primates
Family: Hominidae
Genus: Homo
Species: Homo sapiens
Sequence
MMDGPRSDVGRWGGNPLQPPTTPSPEPEPEPDGRSRRGGGRSFWARCCGCCSCRNAADDD
WGPEPSDSRGRGSSSGTRRPGSRGSDSRRPVSRGSGVNAAGDGTIREGMLVVNGVDLLSS
RSDQNRREHHTDEYEYDELIVRRGQPFHMLLLLSRTYESSDRITLELLIGNNPEVGKGTH
VIIPVGKGGSGGWKAQVVKASGQNLNLRVHTSPNAIIGKFQFTVRTQSDAGEFQLPFDPR
NEIYILFNPWCPEDIVYVDHEDWRQEYVLNESGRIYYGTEAQIGERTWNYGQFDHGVLDA
CLYILDRRGMPYGGRGDPVNVSRVISAMVNSLDDNGVLIGNWSGDYSRGTNPSAWVGSVE
ILLSYLRTGYSVPYGQCWVFAGVTTTVLRCLGLATRTVTNFNSAHDTDTSLTMDIYFDEN
MKPLEHLNHDSVWNFHVWNDCWMKRPDLPSGFDGWQVVDATPQETSSGIFCCGPCSVESI
KNGLVYMKYDTPFIFAEVNSDKVYWQRQDDGSFKIVYVEEKAIGTLIVTKAISSNMREDI
TYLYKHPEGSDAERKAVETAAAHGSKPNVYANRGSAEDVAMQVEAQDAVMGQDLMVSVML
INHSSSRRTVKLHLYLSVTFYTGVSGTIFKETKKEVELAPGASDRVTMPVAYKEYRPHLV
DQGAMLLNVSGHVKESGQVLAKQHTFRLRTPDLSLTLLGAAVVGQECEVQIVFKNPLPVT
LTNVVFRLEGSGLQRPKILNVGDIGGNETVTLRQSFVPVRPGPRQLIASLDSPQLSQVHG
VIQVDVAPAPGDGGFFSDAGGDSHLGETIPMASRGGA
Function This enzyme catalyzes the cross-linking of proteins and the conjugation of polyamines to proteins.
Reactome Pathway
Formation of the cornified envelope (R-HSA-6809371 )

Molecular Expression Atlas (MEA) of This DME

Molecular Expression Atlas (MEA) Jump to Detail Molecular Expression Atlas of This DME
Disease Name ICD 11 Studied Tissue p-value Fold-Change Z-score
Acute myelocytic leukaemia 2B33.1 Bone marrow 2.35E-01 2.91E-02 1.17E-01
Alopecia ED70 Skin from scalp 1.73E-03 -2.17E-01 -4.75E-01
Alzheimer's disease 8A20 Entorhinal cortex 2.89E-01 5.29E-03 3.58E-02
Ankylosing spondylitis FA92.0 Pheripheral blood 4.91E-01 -8.33E-02 -8.56E-01
Aortic stenosis BB70 Calcified aortic valve 4.83E-01 1.11E-01 3.42E-01
Apnea 7A40 Hyperplastic tonsil 7.59E-01 5.71E-01 6.65E-01
Arthropathy FA00-FA5Z Peripheral blood 2.43E-02 9.90E-02 8.82E-01
Asthma CA23 Nasal and bronchial airway 8.68E-03 2.33E-01 3.46E-01
Atopic dermatitis EA80 Skin 8.11E-01 -1.75E-01 -4.44E-01
Autism 6A02 Whole blood 8.06E-01 -4.81E-02 -1.67E-01
Autoimmune uveitis 9A96 Peripheral monocyte 3.48E-01 5.41E-02 3.28E-01
Autosomal dominant monocytopenia 4B04 Whole blood 9.33E-01 -3.30E-02 -2.43E-01
Bacterial infection of gingival 1C1H Gingival tissue 8.95E-01 -9.77E-02 -1.83E-01
Batten disease 5C56.1 Whole blood 5.39E-01 -2.44E-02 -1.64E-01
Behcet's disease 4A62 Peripheral blood 3.65E-01 -4.45E-02 -1.36E-01
Bipolar disorder 6A60-6A6Z Prefrontal cortex 4.44E-01 5.88E-02 3.71E-01
Bladder cancer 2C94 Bladder tissue 1.30E-03 1.15E-01 8.62E-01
Breast cancer 2C60-2C6Z Breast tissue 1.44E-07 -1.57E-01 -4.85E-01
Cardioembolic stroke 8B11.20 Whole blood 8.51E-02 -6.18E-02 -2.17E-01
Cervical cancer 2C77 Cervical tissue 1.67E-04 -2.28E+00 -1.61E+00
Childhood onset rheumatic disease FA20.Z Peripheral blood 1.38E-01 -1.04E-01 -3.44E-01
Chronic hepatitis C 1E51.1 Whole blood 2.82E-02 1.53E-01 1.07E+00
Chronic obstructive pulmonary disease CA22 Lung tissue 7.73E-01 -9.12E-03 -2.62E-02
Chronic obstructive pulmonary disease CA22 Small airway epithelium 2.75E-01 9.15E-02 2.39E-01
Chronic rhinosinusitis CA0A Sinus mucosa tissue 7.55E-01 2.70E-02 9.15E-02
Colon cancer 2B90 Colon tissue 4.27E-01 -4.50E-02 -1.87E-01
Coronary artery disease BA80-BA8Z Peripheral blood 4.49E-01 -1.26E-01 -6.31E-01
Diffuse large B-cell lymphoma 2A81 Tonsil tissue 8.91E-01 1.09E-02 1.99E-02
Endometriosis GA10 Endometrium tissue 2.19E-01 -1.24E-01 -5.85E-01
Familial hypercholesterolemia 5C80.00 Peripheral blood 4.33E-01 9.23E-02 5.09E-01
Familial hypercholesterolemia 5C80.00 Whole blood 4.96E-01 1.04E-02 5.08E-02
Gastric cancer 2B72 Gastric tissue 2.42E-01 -3.67E-01 -1.33E+00
Glioblastopma 2A00.00 Nervous tissue 1.34E-18 -1.36E-01 -5.05E-01
Glioma 2A00.0Y-2A00.0Z Brain stem tissue 4.86E-01 -2.94E-01 -8.61E-01
Glioma 2A00.0Y-2A00.0Z White matter tissue 8.74E-01 2.10E-02 4.60E-02
Head and neck cancer 2D42 Head and neck tissue 1.15E-01 -4.02E-01 -1.48E-01
HIV-associated neurocognitive impairment 8A2Y-8A2Z White matter tissue 4.95E-01 9.07E-03 7.16E-02
Huntington's disease 8A01.10 Whole blood 8.33E-01 3.10E-02 1.41E-01
Idiopathic pulmonary fibrosis CB03.4 Lung tissue 5.35E-01 -1.72E-01 -3.67E-01
Immunodeficiency 4A00-4A20 Peripheral blood 2.10E-02 2.16E-01 2.32E+00
Influenza 1E30 Whole blood 9.59E-03 8.50E-01 3.64E+00
Interstitial cystitis GC00.3 Bladder tissue 1.26E-01 1.63E-01 1.45E+00
Intracranial aneurysm 8B01.0 Intracranial artery 6.07E-02 -2.16E-01 -4.91E-01
Irritable bowel syndrome DD91.0 Rectal colon tissue 6.66E-01 6.39E-03 2.81E-02
Ischemic stroke 8B11 Peripheral blood 9.47E-01 4.52E-02 2.53E-01
Juvenile idiopathic arthritis FA24 Peripheral blood 7.01E-02 -7.54E-02 -2.38E-01
Lateral sclerosis 8B60.4 Skin 2.67E-01 -1.76E-01 -7.05E-01
Lateral sclerosis 8B60.4 Cervical spinal cord 4.13E-01 0.00E+00 0.00E+00
Liver cancer 2C12.0 Liver tissue 2.84E-02 -1.70E-01 -6.95E-01
Liver failure DB99.7-DB99.8 Liver tissue 4.27E-01 -1.25E-01 -4.62E-01
Lung cancer 2C25 Lung tissue 1.83E-19 -4.61E-01 -1.43E+00
Lupus erythematosus 4A40 Whole blood 8.65E-03 -1.92E-01 -3.01E-01
Major depressive disorder 6A70-6A7Z Hippocampus 4.59E-01 3.84E-02 2.39E-01
Major depressive disorder 6A70-6A7Z Whole blood 3.39E-01 2.85E-02 1.21E-01
Melanoma 2C30 Skin 2.41E-01 -6.62E-01 -5.15E-01
Multiple myeloma 2A83.1 Peripheral blood 6.35E-01 -1.60E-02 -6.66E-02
Multiple myeloma 2A83.1 Bone marrow 9.38E-01 -4.34E-02 -2.21E-01
Multiple sclerosis 8A40 Plasmacytoid dendritic cells 5.03E-01 3.22E-02 1.75E-01
Myelodysplastic syndrome 2A36-2A3Z Bone marrow 2.02E-04 7.39E-02 4.20E-01
Myelofibrosis 2A20.2 Whole blood 2.15E-02 -5.35E-02 -3.03E-01
Myocardial infarction BA41-BA50 Peripheral blood 5.38E-02 5.44E-02 1.18E-01
Myopathy 8C70.6 Muscle tissue 1.11E-01 -1.84E-01 -1.69E+00
Neonatal sepsis KA60 Whole blood 9.78E-01 -2.51E-02 -9.33E-02
Neuroectodermal tumour 2A00.11 Brain stem tissue 4.36E-02 -3.48E-01 -7.52E-01
Non-alcoholic fatty liver disease DB92 Liver tissue 1.78E-01 -1.30E-01 -8.46E-01
Obesity related type 2 diabetes 5A11 Omental adipose tissue 5.15E-03 -1.46E+00 -2.06E+00
Olive pollen allergy CA08.00 Peripheral blood 3.28E-01 1.83E-01 6.03E-01
Oral cancer 2B6E Oral tissue 7.12E-05 -1.44E+00 -9.36E-01
Osteoarthritis FA00-FA0Z Synovial tissue 7.54E-02 -1.86E-01 -5.90E-01
Osteoporosis FB83.1 Bone marrow 1.16E-01 2.22E-01 1.01E+00
Ovarian cancer 2C73 Ovarian tissue 8.61E-02 4.44E-01 5.84E-01
Pancreatic cancer 2C10 Pancreas 1.65E-03 -2.01E-01 -8.22E-01
Parkinson's disease 8A00.0 Substantia nigra tissue 6.35E-01 -5.22E-02 -1.45E-01
Pediatric respiratory syncytial virus infection CA40.11 Peripheral blood 2.95E-02 1.24E-01 1.15E+00
Pituitary cancer 2D12 Pituitary tissue 5.72E-01 -4.41E-02 -1.17E-01
Pituitary gonadotrope tumour 2D12 Pituitary tissue 1.86E-01 -2.03E-01 -6.17E-01
Polycystic ovary syndrome 5A80.1 Vastus lateralis muscle 5.59E-01 -4.61E-02 -2.35E-01
Polycythemia vera 2A20.4 Whole blood 3.94E-02 -7.57E-02 -3.97E-01
Pompe disease 5C51.3 Biceps muscle 3.53E-01 -5.26E-02 -3.35E-01
Preterm birth KA21.4Z Myometrium 5.49E-01 -1.47E-01 -6.11E-01
Prostate cancer 2C82 Prostate 6.83E-07 -1.01E+00 -1.75E+00
Psoriasis EA90 Skin 3.71E-51 1.60E+00 3.22E+00
Rectal cancer 2B92 Rectal colon tissue 3.20E-01 -5.31E-03 -1.50E-02
Renal cancer 2C90-2C91 Kidney 2.34E-02 -3.53E-01 -1.09E+00
Retinoblastoma 2D02.2 Uvea 1.32E-01 -1.36E-01 -9.35E-01
Rheumatoid arthritis FA20 Synovial tissue 5.33E-03 -5.62E-01 -1.57E+00
Rhinovirus infection CA42.1 Nasal epithelium tissue 5.73E-01 3.16E-02 1.03E-01
Schizophrenia 6A20 Prefrontal cortex 7.36E-01 -2.99E-03 -1.51E-02
Schizophrenia 6A20 Superior temporal cortex 3.95E-01 -5.95E-02 -4.34E-01
Scleroderma 4A42.Z Whole blood 6.71E-04 3.85E-01 1.63E+00
Seizure 8A60-8A6Z Whole blood 6.09E-01 -1.52E-02 -4.30E-02
Sensitive skin EK0Z Skin 3.88E-01 3.62E-03 7.81E-03
Sepsis with septic shock 1G41 Whole blood 1.31E-01 5.79E-02 1.94E-01
Shwachman-Diamond syndrome 3A70.0 Bone marrow 1.01E-01 -8.22E-02 -1.32E+00
Sickle cell disease 3A51.0-3A51.3 Peripheral blood 6.56E-01 3.62E-02 1.64E-01
Simpson golabi behmel syndrome LD2C Adipose tissue 4.19E-01 -1.26E-01 -1.80E+00
Sjogren's syndrome 4A43.2 Salivary gland tissue 4.10E-01 -1.25E-01 -6.55E-01
Skin cancer 2C30-2C3Z Skin 9.97E-48 -1.98E+00 -3.11E+00
Thrombocythemia 3B63 Whole blood 1.20E-01 -1.46E-02 -8.15E-02
Thrombocytopenia 3B64 Whole blood 1.33E-01 4.12E-01 1.12E+00
Thyroid cancer 2D10 Thyroid 2.70E-14 3.43E-01 1.11E+00
Tibial muscular dystrophy 8C75 Muscle tissue 3.19E-03 -1.33E-01 -7.66E-01
Tuberous sclerosis complex LD2D.2 Perituberal tissue 4.73E-01 6.75E-02 7.20E-01
Type 2 diabetes 5A11 Liver tissue 8.65E-02 -2.03E-01 -1.01E+00
Ureter cancer 2C92 Urothelium 7.94E-01 3.06E-02 1.07E-01
Uterine cancer 2C78 Endometrium tissue 2.68E-01 1.93E-01 1.14E-01
Vitiligo ED63.0 Skin 4.71E-01 -5.52E-02 -1.50E-01
------------------------------------------------------------------------------------
⏷ Show the Full List of DME Expression Under 107 Diseases