Details of Drug-Metabolizing Enzyme (DME)

General Information of Drug-Metabolizing Enzyme (DME) (ID: DEFNVD7)

DME Name Ras proteins prenyltransferase alpha (FNTA)
Synonyms
CAAX farnesyltransferase subunit alpha; Protein farnesyltransferase/geranylgeranyltransferase type-1 subunit alpha; Ras proteins prenyltransferase subunit alpha; Type I protein geranyl-geranyltransferase subunit alpha; FTase-alpha; GGTase-I-alpha; FNTA
Gene Name FNTA
UniProt ID
FNTA_HUMAN
INTEDE ID
DME0575
3D Structure
Download
2D Sequence (FASTA)
Download
3D Structure (PDB)
Download
Gene ID
2339
EC Number EC: 2.5.1.58
Transferase
Alkyl/aryl transferase
Alkyl/aryl transferase
EC: 2.5.1.58
Lineage Species: Homo sapiens
Kingdom: Metazoa
Phylum: Chordata
Class: Mammalia
Order: Primates
Family: Hominidae
Genus: Homo
Species: Homo sapiens
Sequence
MAATEGVGEAAQGGEPGQPAQPPPQPHPPPPQQQHKEEMAAEAGEAVASPMDDGFVSLDS
PSYVLYRDRAEWADIDPVPQNDGPNPVVQIIYSDKFRDVYDYFRAVLQRDERSERAFKLT
RDAIELNAANYTVWHFRRVLLKSLQKDLHEEMNYITAIIEEQPKNYQVWHHRRVLVEWLR
DPSQELEFIADILNQDAKNYHAWQHRQWVIQEFKLWDNELQYVDQLLKEDVRNNSVWNQR
YFVISNTTGYNDRAVLEREVQYTLEMIKLVPHNESAWNYLKGILQDRGLSKYPNLLNQLL
DLQPSHSSPYLIAFLVDIYEDMLENQCDNKEDILNKALELCEILAKEKDTIRKEYWRYIG
RSLQSKHSTENDSPTNVQQ
Function
This enzyme is essential subunit of both the farnesyltransferase and the geranylgeranyltransferase complex. It contributes to the transfer of a farnesyl or geranylgeranyl moiety from farnesyl or geranylgeranyl diphosphate to a cysteine at the fourth position from the C-terminus of several proteins having the C-terminal sequence Cys-aliphatic- aliphatic-X.
KEGG Pathway
Terpenoid backbone biosynthesis (hsa00900 )
Reactome Pathway
Inactivation, recovery and regulation of the phototransduction cascade (R-HSA-2514859 )
Apoptotic cleavage of cellular proteins (R-HSA-111465 )

Molecular Interaction Atlas (MIA) of This DME

Molecular Interaction Atlas (MIA) Jump to Detail Molecular Interaction Atlas of This DME
1 Discontinued Drug(s) Metabolized by This DME
Drug Name Drug ID Indication ICD 11 Highest Status REF
SQ-32709 DMSQRXW Arteriosclerosis BD40 Discontinued in Phase 2 [1]

Molecular Expression Atlas (MEA) of This DME

Molecular Expression Atlas (MEA) Jump to Detail Molecular Expression Atlas of This DME
Disease Name ICD 11 Studied Tissue p-value Fold-Change Z-score
Acute myelocytic leukaemia 2B33.1 Bone marrow 4.47E-07 2.68E-01 4.89E-01
Alopecia ED70 Skin from scalp 1.64E-01 -2.37E-02 -1.01E-01
Alzheimer's disease 8A20 Entorhinal cortex 2.83E-01 9.18E-02 2.04E-01
Ankylosing spondylitis FA92.0 Pheripheral blood 4.77E-01 1.76E-01 6.77E-01
Aortic stenosis BB70 Calcified aortic valve 8.19E-01 3.24E-01 2.44E-01
Apnea 7A40 Hyperplastic tonsil 7.11E-01 -3.61E-01 -3.29E-01
Arthropathy FA00-FA5Z Peripheral blood 6.47E-02 -1.25E-01 -5.88E-01
Asthma CA23 Nasal and bronchial airway 5.84E-01 -9.97E-02 -1.85E-01
Atopic dermatitis EA80 Skin 6.02E-11 -7.52E-01 -4.00E+00
Autism 6A02 Whole blood 7.68E-01 1.32E-01 2.12E-01
Autoimmune uveitis 9A96 Peripheral monocyte 5.35E-01 -4.99E-01 -7.66E-01
Autosomal dominant monocytopenia 4B04 Whole blood 9.05E-02 -7.74E-01 -1.38E+00
Bacterial infection of gingival 1C1H Gingival tissue 9.17E-11 -3.45E-01 -1.10E+00
Batten disease 5C56.1 Whole blood 1.38E-01 -4.39E-01 -1.85E+00
Behcet's disease 4A62 Peripheral blood 3.62E-01 6.66E-02 2.45E-01
Bipolar disorder 6A60-6A6Z Prefrontal cortex 5.44E-01 -2.31E-02 -1.32E-01
Bladder cancer 2C94 Bladder tissue 1.85E-24 -9.69E-01 -1.19E+01
Breast cancer 2C60-2C6Z Breast tissue 8.11E-01 2.00E-01 3.25E-01
Cardioembolic stroke 8B11.20 Whole blood 3.85E-08 -3.26E-01 -1.98E+00
Cervical cancer 2C77 Cervical tissue 4.29E-02 3.08E-01 6.14E-01
Childhood onset rheumatic disease FA20.Z Peripheral blood 9.57E-01 -7.91E-02 -1.59E-01
Chronic hepatitis C 1E51.1 Whole blood 2.03E-01 -2.43E-01 -1.16E+00
Chronic obstructive pulmonary disease CA22 Lung tissue 2.06E-02 -1.78E-01 -5.87E-01
Chronic obstructive pulmonary disease CA22 Small airway epithelium 9.09E-06 -2.04E-01 -6.28E-01
Chronic rhinosinusitis CA0A Sinus mucosa tissue 3.39E-01 1.40E-01 3.06E-01
Colon cancer 2B90 Colon tissue 1.36E-07 1.43E-01 3.80E-01
Coronary artery disease BA80-BA8Z Peripheral blood 7.84E-01 5.97E-02 2.00E-01
Diffuse large B-cell lymphoma 2A81 Tonsil tissue 9.12E-01 8.63E-01 8.41E-01
Endometriosis GA10 Endometrium tissue 9.44E-01 -2.44E-02 -7.19E-02
Familial hypercholesterolemia 5C80.00 Peripheral blood 7.57E-01 -3.11E-03 -2.25E-02
Familial hypercholesterolemia 5C80.00 Whole blood 6.96E-05 6.61E-01 1.40E+00
Gastric cancer 2B72 Gastric tissue 3.32E-01 9.71E-02 4.31E-01
Glioblastopma 2A00.00 Nervous tissue 2.46E-14 3.40E-01 5.02E-01
Glioma 2A00.0Y-2A00.0Z Brain stem tissue 5.48E-01 5.83E-01 6.86E-01
Glioma 2A00.0Y-2A00.0Z White matter tissue 7.02E-01 9.53E-02 2.47E-01
Head and neck cancer 2D42 Head and neck tissue 3.86E-01 -1.10E-01 -3.34E-01
HIV-associated neurocognitive impairment 8A2Y-8A2Z White matter tissue 3.36E-01 2.48E-01 3.26E-01
Huntington's disease 8A01.10 Whole blood 9.16E-01 3.78E-02 6.63E-02
Idiopathic pulmonary fibrosis CB03.4 Lung tissue 5.94E-02 6.66E-02 5.72E-01
Immunodeficiency 4A00-4A20 Peripheral blood 5.85E-02 -3.91E-01 -1.21E+00
Influenza 1E30 Whole blood 3.36E-03 -9.09E-01 -3.53E+00
Interstitial cystitis GC00.3 Bladder tissue 3.94E-04 -3.21E-01 -3.17E+00
Intracranial aneurysm 8B01.0 Intracranial artery 9.40E-01 1.84E-01 4.39E-01
Irritable bowel syndrome DD91.0 Rectal colon tissue 5.26E-01 -2.38E-02 -1.63E-01
Ischemic stroke 8B11 Peripheral blood 6.33E-01 -2.66E-01 -7.10E-01
Juvenile idiopathic arthritis FA24 Peripheral blood 8.14E-07 -1.61E-01 -8.78E-01
Lateral sclerosis 8B60.4 Skin 6.14E-02 -2.19E-01 -1.39E+00
Lateral sclerosis 8B60.4 Cervical spinal cord 6.85E-03 -5.33E-01 -1.07E+00
Liver cancer 2C12.0 Liver tissue 9.65E-02 1.85E-01 2.52E-01
Liver failure DB99.7-DB99.8 Liver tissue 1.91E-03 -6.18E-01 -2.18E+00
Lung cancer 2C25 Lung tissue 1.40E-07 -2.21E-01 -4.51E-01
Lupus erythematosus 4A40 Whole blood 2.48E-01 -1.20E-01 -3.38E-01
Major depressive disorder 6A70-6A7Z Hippocampus 2.42E-01 -5.67E-02 -3.21E-01
Major depressive disorder 6A70-6A7Z Whole blood 3.85E-01 -6.80E-03 -2.59E-02
Melanoma 2C30 Skin 2.19E-01 4.73E-01 5.33E-01
Multiple myeloma 2A83.1 Peripheral blood 3.61E-01 -6.76E-02 -2.40E-01
Multiple myeloma 2A83.1 Bone marrow 4.34E-02 2.25E-01 1.17E+00
Multiple sclerosis 8A40 Plasmacytoid dendritic cells 9.83E-01 -1.52E-02 -3.85E-02
Myelodysplastic syndrome 2A36-2A3Z Bone marrow 2.05E-01 1.54E-01 3.66E-01
Myelofibrosis 2A20.2 Whole blood 3.86E-13 -5.57E-01 -2.82E+00
Myocardial infarction BA41-BA50 Peripheral blood 1.84E-02 -2.04E-01 -3.47E-01
Myopathy 8C70.6 Muscle tissue 7.70E-01 -6.96E-03 -2.11E-02
Neonatal sepsis KA60 Whole blood 1.92E-01 -5.72E-02 -9.51E-02
Neuroectodermal tumour 2A00.11 Brain stem tissue 1.97E-05 -5.12E-01 -1.60E+00
Non-alcoholic fatty liver disease DB92 Liver tissue 1.50E-01 1.22E-01 2.13E-01
Obesity related type 2 diabetes 5A11 Omental adipose tissue 1.37E-01 -1.87E-01 -9.91E-01
Olive pollen allergy CA08.00 Peripheral blood 3.99E-02 -6.27E-01 -1.47E+00
Oral cancer 2B6E Oral tissue 7.16E-01 2.29E-01 3.02E-01
Osteoarthritis FA00-FA0Z Synovial tissue 5.95E-01 1.42E-01 1.51E-01
Osteoporosis FB83.1 Bone marrow 4.75E-01 6.79E-02 5.04E-01
Ovarian cancer 2C73 Ovarian tissue 9.38E-03 7.92E-01 1.28E+00
Pancreatic cancer 2C10 Pancreas 6.38E-02 4.26E-01 5.79E-01
Parkinson's disease 8A00.0 Substantia nigra tissue 6.71E-02 -2.48E-01 -7.05E-01
Pediatric respiratory syncytial virus infection CA40.11 Peripheral blood 1.37E-02 -1.63E-01 -9.97E-01
Pituitary cancer 2D12 Pituitary tissue 2.12E-01 -3.61E-01 -4.89E-01
Pituitary gonadotrope tumour 2D12 Pituitary tissue 3.58E-03 -5.02E-01 -1.03E+00
Polycystic ovary syndrome 5A80.1 Vastus lateralis muscle 3.20E-01 1.19E-01 4.88E-01
Polycythemia vera 2A20.4 Whole blood 3.23E-23 -7.09E-01 -2.79E+00
Pompe disease 5C51.3 Biceps muscle 3.33E-02 2.30E-01 1.66E+00
Preterm birth KA21.4Z Myometrium 4.22E-01 1.47E-01 1.10E-01
Prostate cancer 2C82 Prostate 5.01E-03 -2.59E-01 -4.28E-01
Psoriasis EA90 Skin 9.30E-09 -1.12E-01 -3.00E-01
Rectal cancer 2B92 Rectal colon tissue 5.43E-01 -9.75E-02 -4.00E-01
Renal cancer 2C90-2C91 Kidney 3.08E-02 4.40E-01 5.08E-01
Retinoblastoma 2D02.2 Uvea 5.19E-01 3.52E-02 1.27E-01
Rheumatoid arthritis FA20 Synovial tissue 3.28E-03 1.93E+00 2.04E+00
Rhinovirus infection CA42.1 Nasal epithelium tissue 1.73E-02 7.95E-02 4.52E-01
Schizophrenia 6A20 Prefrontal cortex 8.67E-01 5.14E-02 7.98E-02
Schizophrenia 6A20 Superior temporal cortex 1.71E-01 1.56E-02 5.60E-02
Scleroderma 4A42.Z Whole blood 8.37E-09 -3.78E-01 -3.55E+00
Seizure 8A60-8A6Z Whole blood 2.29E-01 3.43E-01 9.89E-01
Sensitive skin EK0Z Skin 5.94E-01 1.12E-01 5.27E-01
Sepsis with septic shock 1G41 Whole blood 2.16E-22 -4.80E-01 -9.93E-01
Shwachman-Diamond syndrome 3A70.0 Bone marrow 5.39E-01 -3.87E-01 -5.99E-01
Sickle cell disease 3A51.0-3A51.3 Peripheral blood 7.47E-02 -1.28E-01 -2.12E-01
Simpson golabi behmel syndrome LD2C Adipose tissue 2.83E-01 -5.43E-02 -3.98E-01
Sjogren's syndrome 4A43.2 Salivary gland tissue 1.68E-01 1.75E-01 4.34E+00
Skin cancer 2C30-2C3Z Skin 9.19E-13 -4.27E-01 -7.95E-01
Thrombocythemia 3B63 Whole blood 8.71E-10 -6.00E-01 -2.75E+00
Thrombocytopenia 3B64 Whole blood 3.53E-01 -9.14E-01 -1.08E+00
Thyroid cancer 2D10 Thyroid 7.43E-01 1.27E-02 3.09E-02
Tibial muscular dystrophy 8C75 Muscle tissue 8.54E-01 -3.63E-02 -1.34E-01
Tuberous sclerosis complex LD2D.2 Perituberal tissue 1.68E-01 -4.03E-01 -6.45E+00
Type 2 diabetes 5A11 Liver tissue 6.35E-01 8.40E-02 5.46E-01
Ureter cancer 2C92 Urothelium 6.68E-01 -2.15E-02 -1.36E-01
Uterine cancer 2C78 Endometrium tissue 1.53E-01 -7.68E-02 -1.03E-01
Vitiligo ED63.0 Skin 8.04E-01 -1.01E-02 -7.62E-02
------------------------------------------------------------------------------------
⏷ Show the Full List of DME Expression Under 107 Diseases

References

1 Site-selective enzymatic labeling of designed ankyrin repeat proteins using protein farnesyltransferase. Methods Mol Biol. 2019;2033:207-219.