Details of Drug-Metabolizing Enzyme (DME)

General Information of Drug-Metabolizing Enzyme (DME) (ID: DEG5L6E)

DME Name Agmatine ureohydrolase (AGMAT)
Synonyms Agmatinase; AGMAT; AUH; Mitochondrial agmatinase; SpeB
Gene Name AGMAT
UniProt ID
SPEB_HUMAN
INTEDE ID
DME0587
3D Structure
Download
2D Sequence (FASTA)
Download
3D Structure (PDB)
Download
Gene ID
79814
EC Number EC: 3.5.3.11
Hydrolases
Carbon-nitrogen hydrolase
Linear amidine hydrolase
EC: 3.5.3.11
Lineage Species: Homo sapiens
Kingdom: Metazoa
Phylum: Chordata
Class: Mammalia
Order: Primates
Family: Hominidae
Genus: Homo
Species: Homo sapiens
Sequence
MLRLLASGCARGPGPGVGARPAAGLFHPGRRQSRQASDAPRNQPPSPEFVARPVGVCSMM
RLPVQTSPEGLDAAFIGVPLDTGTSNRPGARFGPRRIREESVMLGTVNPSTGALPFQSLM
VADLGDVNVNLYNLQDSCRRIQEAYEKIVAAGCIPLTLGGDHTITYPILQAMAKKHGPVG
LLHVDAHTDTTDKALGEKLYHGAPFRRCVDEGLLDCKRVVQIGIRGSSTTLDPYRYNRSQ
GFRVVLAEDCWMKSLVPLMGEVRQQMGGKPIYISFDIDALDPAYAPGTGTPEIAGLTPSQ
ALEIIRGCQGLNVMGCDLVEVSPPYDLSGNTALLAANLLFEMLCALPKVTTV
Function
This enzyme belongs to the family of hydrolases, those acting on carbon-nitrogen bonds other than peptide bonds, specifically in linear amidines. And it participates in urea cycle and metabolism of amino groups.
KEGG Pathway
Arginine and proline metabolism (hsa00330 )
Metabolic pathways (hsa01100 )
Reactome Pathway
Agmatine biosynthesis (R-HSA-351143 )

Molecular Interaction Atlas (MIA) of This DME

Molecular Interaction Atlas (MIA) Jump to Detail Molecular Interaction Atlas of This DME
1 Investigative Drug(s) Metabolized by This DME
Drug Name Drug ID Indication ICD 11 Highest Status REF
agmatine DMSBZ29 Discovery agent N.A. Investigative [1]

Molecular Expression Atlas (MEA) of This DME

Molecular Expression Atlas (MEA) Jump to Detail Molecular Expression Atlas of This DME
Disease Name ICD 11 Studied Tissue p-value Fold-Change Z-score
Acute myelocytic leukaemia 2B33.1 Bone marrow 2.69E-11 9.53E-02 4.79E-01
Alopecia ED70 Skin from scalp 3.88E-01 -6.11E-02 -2.37E-01
Alzheimer's disease 8A20 Entorhinal cortex 9.24E-04 -9.69E-02 -3.15E-01
Ankylosing spondylitis FA92.0 Pheripheral blood 1.78E-01 -9.00E-02 -5.84E-01
Aortic stenosis BB70 Calcified aortic valve 8.91E-01 8.38E-02 1.66E-01
Apnea 7A40 Hyperplastic tonsil 1.67E-03 1.26E+00 1.08E+01
Arthropathy FA00-FA5Z Peripheral blood 4.45E-01 -7.45E-02 -2.97E-01
Asthma CA23 Nasal and bronchial airway 1.90E-02 9.06E-02 2.61E-01
Atopic dermatitis EA80 Skin 2.99E-04 1.08E-01 5.71E-01
Autism 6A02 Whole blood 1.20E-02 -2.10E-01 -9.18E-01
Autoimmune uveitis 9A96 Peripheral monocyte 7.24E-01 1.05E-01 4.51E-01
Autosomal dominant monocytopenia 4B04 Whole blood 1.02E-01 4.39E-02 2.11E-01
Bacterial infection of gingival 1C1H Gingival tissue 4.97E-01 -3.19E-02 -1.46E-01
Batten disease 5C56.1 Whole blood 2.16E-01 -3.42E-01 -1.50E+00
Behcet's disease 4A62 Peripheral blood 5.98E-01 6.79E-02 1.87E-01
Bipolar disorder 6A60-6A6Z Prefrontal cortex 5.95E-02 -1.81E-01 -5.85E-01
Bladder cancer 2C94 Bladder tissue 7.70E-05 6.67E-01 2.58E+00
Breast cancer 2C60-2C6Z Breast tissue 8.17E-66 4.02E-01 1.36E+00
Cardioembolic stroke 8B11.20 Whole blood 3.52E-01 1.40E-01 3.68E-01
Cervical cancer 2C77 Cervical tissue 8.69E-04 3.22E-01 1.24E+00
Childhood onset rheumatic disease FA20.Z Peripheral blood 1.03E-01 -5.80E-02 -8.56E-02
Chronic hepatitis C 1E51.1 Whole blood 3.28E-01 3.04E-02 1.79E-01
Chronic obstructive pulmonary disease CA22 Lung tissue 6.67E-02 1.18E-01 6.42E-01
Chronic obstructive pulmonary disease CA22 Small airway epithelium 7.92E-01 -3.37E-02 -2.07E-01
Chronic rhinosinusitis CA0A Sinus mucosa tissue 6.65E-02 2.36E-01 1.84E+00
Colon cancer 2B90 Colon tissue 4.84E-19 4.93E-01 9.84E-01
Coronary artery disease BA80-BA8Z Peripheral blood 2.40E-02 -2.60E-01 -1.69E+00
Diffuse large B-cell lymphoma 2A81 Tonsil tissue 9.62E-01 5.02E-02 1.20E-01
Endometriosis GA10 Endometrium tissue 3.31E-03 -2.08E-01 -6.64E-01
Familial hypercholesterolemia 5C80.00 Peripheral blood 2.38E-01 5.45E-02 3.98E-01
Familial hypercholesterolemia 5C80.00 Whole blood 6.50E-11 -1.04E+00 -2.15E+00
Gastric cancer 2B72 Gastric tissue 2.37E-02 1.72E+00 3.62E+00
Glioblastopma 2A00.00 Nervous tissue 1.05E-49 -3.17E-01 -8.89E-01
Glioma 2A00.0Y-2A00.0Z Brain stem tissue 2.46E-01 -5.61E-01 -1.74E+00
Glioma 2A00.0Y-2A00.0Z White matter tissue 2.78E-02 -2.26E-01 -7.88E-01
Head and neck cancer 2D42 Head and neck tissue 4.07E-05 1.95E-01 5.68E-01
HIV-associated neurocognitive impairment 8A2Y-8A2Z White matter tissue 3.63E-02 -1.65E-01 -7.78E-01
Huntington's disease 8A01.10 Whole blood 3.70E-01 6.44E-02 4.37E-01
Idiopathic pulmonary fibrosis CB03.4 Lung tissue 5.19E-01 -1.62E-01 -5.58E-01
Immunodeficiency 4A00-4A20 Peripheral blood 1.32E-04 3.26E-01 2.15E+00
Influenza 1E30 Whole blood 2.78E-02 4.33E-01 2.19E+00
Interstitial cystitis GC00.3 Bladder tissue 3.15E-01 1.15E-01 1.14E+00
Intracranial aneurysm 8B01.0 Intracranial artery 1.94E-02 3.59E-01 1.46E+00
Irritable bowel syndrome DD91.0 Rectal colon tissue 6.41E-01 7.41E-02 1.91E-01
Ischemic stroke 8B11 Peripheral blood 7.81E-01 1.12E-01 3.46E-01
Juvenile idiopathic arthritis FA24 Peripheral blood 6.19E-07 -2.60E-01 -7.73E-01
Lateral sclerosis 8B60.4 Skin 9.66E-02 4.92E-01 1.64E+00
Lateral sclerosis 8B60.4 Cervical spinal cord 7.39E-01 1.99E-01 6.48E-01
Liver cancer 2C12.0 Liver tissue 1.61E-06 -5.52E-01 -8.18E-01
Liver failure DB99.7-DB99.8 Liver tissue 1.45E-01 -8.23E-01 -2.26E+00
Lung cancer 2C25 Lung tissue 2.53E-120 1.07E+00 3.23E+00
Lupus erythematosus 4A40 Whole blood 3.22E-09 -2.06E-01 -4.37E-01
Major depressive disorder 6A70-6A7Z Hippocampus 3.93E-01 -6.39E-02 -2.15E-01
Major depressive disorder 6A70-6A7Z Whole blood 3.63E-01 -8.45E-02 -2.98E-01
Melanoma 2C30 Skin 7.07E-03 4.11E-01 8.57E-01
Multiple myeloma 2A83.1 Peripheral blood 6.58E-01 -6.05E-01 -7.52E-01
Multiple myeloma 2A83.1 Bone marrow 3.42E-02 -4.30E-01 -1.39E+00
Multiple sclerosis 8A40 Plasmacytoid dendritic cells 7.32E-01 -4.62E-02 -1.51E-01
Myelodysplastic syndrome 2A36-2A3Z Bone marrow 6.08E-04 1.01E-01 5.48E-01
Myelofibrosis 2A20.2 Whole blood 1.86E-03 -3.64E-01 -3.06E+00
Myocardial infarction BA41-BA50 Peripheral blood 4.77E-01 -1.18E-01 -1.61E-01
Myopathy 8C70.6 Muscle tissue 3.64E-04 -1.12E+00 -3.39E+00
Neonatal sepsis KA60 Whole blood 1.05E-24 -6.49E-01 -1.98E+00
Neuroectodermal tumour 2A00.11 Brain stem tissue 2.75E-01 -8.57E-02 -2.46E-01
Non-alcoholic fatty liver disease DB92 Liver tissue 2.83E-04 6.05E-01 2.29E+00
Obesity related type 2 diabetes 5A11 Omental adipose tissue 5.51E-01 -1.10E-02 -1.48E-01
Olive pollen allergy CA08.00 Peripheral blood 6.50E-01 1.89E-02 1.65E-01
Oral cancer 2B6E Oral tissue 3.50E-02 4.78E-01 8.56E-01
Osteoarthritis FA00-FA0Z Synovial tissue 4.28E-01 -1.29E-01 -1.17E-01
Osteoporosis FB83.1 Bone marrow 1.48E-01 -2.63E-01 -4.71E-01
Ovarian cancer 2C73 Ovarian tissue 1.98E-05 8.08E-01 2.76E+00
Pancreatic cancer 2C10 Pancreas 1.87E-02 1.91E-01 3.61E-01
Parkinson's disease 8A00.0 Substantia nigra tissue 5.29E-01 9.23E-03 3.49E-02
Pediatric respiratory syncytial virus infection CA40.11 Peripheral blood 6.16E-01 7.40E-02 2.56E-01
Pituitary cancer 2D12 Pituitary tissue 5.44E-01 -1.60E-01 -5.46E-01
Pituitary gonadotrope tumour 2D12 Pituitary tissue 7.25E-01 -2.29E-02 -7.70E-02
Polycystic ovary syndrome 5A80.1 Vastus lateralis muscle 7.54E-02 2.05E-01 6.43E-01
Polycythemia vera 2A20.4 Whole blood 2.24E-14 -2.60E-01 -1.99E+00
Pompe disease 5C51.3 Biceps muscle 1.19E-06 -2.13E+00 -3.15E+00
Preterm birth KA21.4Z Myometrium 9.36E-01 -1.82E-02 -8.48E-02
Prostate cancer 2C82 Prostate 3.29E-01 -3.10E-01 -6.08E-01
Psoriasis EA90 Skin 3.05E-04 -1.91E-01 -5.64E-01
Rectal cancer 2B92 Rectal colon tissue 1.85E-03 5.15E-01 2.58E+00
Renal cancer 2C90-2C91 Kidney 2.39E-03 -2.06E+00 -1.45E+00
Retinoblastoma 2D02.2 Uvea 6.36E-04 2.34E-01 1.43E+00
Rheumatoid arthritis FA20 Synovial tissue 2.32E-01 -2.39E-01 -1.99E-01
Rhinovirus infection CA42.1 Nasal epithelium tissue 4.41E-01 -2.66E-02 -1.39E-01
Schizophrenia 6A20 Prefrontal cortex 7.97E-01 -2.59E-02 -8.06E-02
Schizophrenia 6A20 Superior temporal cortex 7.52E-01 1.50E-01 5.96E-01
Scleroderma 4A42.Z Whole blood 7.68E-01 -2.02E-02 -7.45E-02
Seizure 8A60-8A6Z Whole blood 8.01E-01 1.26E-01 2.41E-01
Sensitive skin EK0Z Skin 9.83E-01 -3.53E-02 -2.03E-01
Sepsis with septic shock 1G41 Whole blood 6.37E-33 -4.36E-01 -1.15E+00
Shwachman-Diamond syndrome 3A70.0 Bone marrow 8.90E-02 6.19E-02 2.61E-01
Sickle cell disease 3A51.0-3A51.3 Peripheral blood 6.81E-03 -2.11E-01 -1.14E+00
Simpson golabi behmel syndrome LD2C Adipose tissue 9.45E-02 2.58E-01 3.04E+00
Sjogren's syndrome 4A43.2 Salivary gland tissue 3.47E-01 -4.26E-01 -9.49E-01
Skin cancer 2C30-2C3Z Skin 3.39E-06 1.32E-01 3.65E-01
Thrombocythemia 3B63 Whole blood 1.31E-03 -1.53E-01 -1.24E+00
Thrombocytopenia 3B64 Whole blood 4.68E-01 8.22E-01 7.09E-01
Thyroid cancer 2D10 Thyroid 9.80E-02 -1.32E-01 -2.62E-01
Tibial muscular dystrophy 8C75 Muscle tissue 6.98E-04 -5.74E-01 -1.17E+00
Tuberous sclerosis complex LD2D.2 Perituberal tissue 1.32E-01 -1.70E-01 -8.86E-01
Type 2 diabetes 5A11 Liver tissue 3.82E-01 -4.65E-01 -9.68E-01
Ureter cancer 2C92 Urothelium 6.67E-01 1.60E-02 1.01E-01
Uterine cancer 2C78 Endometrium tissue 5.11E-01 1.51E-02 2.77E-02
Vitiligo ED63.0 Skin 1.84E-01 4.62E-02 2.86E-01
------------------------------------------------------------------------------------
⏷ Show the Full List of DME Expression Under 107 Diseases

References

1 Metabolic strategies for the degradation of the neuromodulator agmatine in mammals. Metabolism. 2018 Apr;81:35-44.