Details of Drug-Metabolizing Enzyme (DME)

General Information of Drug-Metabolizing Enzyme (DME) (ID: DEGI1A9)

DME Name N-acetylglutamate synthase (NAGS)
Synonyms
Amino-acid acetyltransferase; N-acetylglutamate synthase conserved domain form; N-acetylglutamate synthase long form; N-acetylglutamate synthase short form; N-acetylglutamate synthase, mitochondrial; NAGS
Gene Name NAGS
UniProt ID
NAGS_HUMAN
INTEDE ID
DME0534
3D Structure
Download
2D Sequence (FASTA)
Download
3D Structure (PDB)
Download
Gene ID
162417
EC Number EC: 2.3.1.1
Transferase
Acyltransferase
Acyltransferase
EC: 2.3.1.1
Lineage Species: Homo sapiens
Kingdom: Metazoa
Phylum: Chordata
Class: Mammalia
Order: Primates
Family: Hominidae
Genus: Homo
Species: Homo sapiens
Sequence
MATALMAVVLRAAAVAPRLRGRGGTGGARRLSCGARRRAARGTSPGRRLSTAWSQPQPPP
EEYAGADDVSQSPVAEEPSWVPSPRPPVPHESPEPPSGRSLVQRDIQAFLNQCGASPGEA
RHWLTQFQTCHHSADKPFAVIEVDEEVLKCQQGVSSLAFALAFLQRMDMKPLVVLGLPAP
TAPSGCLSFWEAKAQLAKSCKVLVDALRHNAAAAVPFFGGGSVLRAAEPAPHASYGGIVS
VETDLLQWCLESGSIPILCPIGETAARRSVLLDSLEVTASLAKALRPTKIIFLNNTGGLR
DSSHKVLSNVNLPADLDLVCNAEWVSTKERQQMRLIVDVLSRLPHHSSAVITAASTLLTE
LFSNKGSGTLFKNAERMLRVRSLDKLDQGRLVDLVNASFGKKLRDDYLASLRPRLHSIYV
SEGYNAAAILTMEPVLGGTPYLDKFVVSSSRQGQGSGQMLWECLRRDLQTLFWRSRVTNP
INPWYFKHSDGSFSNKQWIFFWFGLADIRDSYELVNHAKGLPDSFHKPASDPGS
Function This enzyme catalyzes the production of N-acetylglutamate (NAG) from glutamate and acetyl-CoA.
KEGG Pathway
2-Oxocarboxylic acid metabolism (hsa01210 )
Arginine biosynthesis (hsa00220 )
Biosynthesis of amino acids (hsa01230 )
Metabolic pathways (hsa01100 )
Reactome Pathway
Urea cycle (R-HSA-70635 )

Molecular Expression Atlas (MEA) of This DME

Molecular Expression Atlas (MEA) Jump to Detail Molecular Expression Atlas of This DME
Disease Name ICD 11 Studied Tissue p-value Fold-Change Z-score
Acute myelocytic leukaemia 2B33.1 Bone marrow 1.36E-03 -6.68E-02 -2.58E-01
Alopecia ED70 Skin from scalp 1.45E-01 1.76E-01 5.87E-01
Alzheimer's disease 8A20 Entorhinal cortex 1.43E-05 1.33E-01 4.32E-01
Ankylosing spondylitis FA92.0 Pheripheral blood 5.18E-01 1.87E-01 7.15E-01
Aortic stenosis BB70 Calcified aortic valve 5.62E-01 2.02E-01 3.81E-01
Apnea 7A40 Hyperplastic tonsil 2.05E-01 -9.04E-02 -3.16E-01
Arthropathy FA00-FA5Z Peripheral blood 1.16E-01 -1.77E-01 -7.89E-01
Asthma CA23 Nasal and bronchial airway 1.55E-05 1.73E-01 3.75E-01
Atopic dermatitis EA80 Skin 5.94E-10 4.03E-01 4.42E+00
Autism 6A02 Whole blood 9.21E-01 -4.67E-02 -1.81E-01
Autoimmune uveitis 9A96 Peripheral monocyte 4.07E-01 6.53E-02 5.00E-01
Autosomal dominant monocytopenia 4B04 Whole blood 1.52E-01 -4.39E-01 -1.60E+00
Bacterial infection of gingival 1C1H Gingival tissue 2.12E-01 -2.86E-02 -1.26E-01
Batten disease 5C56.1 Whole blood 7.56E-01 -1.44E-02 -8.36E-02
Behcet's disease 4A62 Peripheral blood 7.53E-01 1.64E-01 6.44E-01
Bipolar disorder 6A60-6A6Z Prefrontal cortex 8.18E-01 5.08E-02 2.20E-01
Bladder cancer 2C94 Bladder tissue 2.48E-03 5.30E-01 1.36E+00
Breast cancer 2C60-2C6Z Breast tissue 2.56E-03 -1.60E-02 -4.04E-02
Cardioembolic stroke 8B11.20 Whole blood 6.76E-01 4.51E-02 1.27E-01
Cervical cancer 2C77 Cervical tissue 4.14E-02 1.43E-01 6.07E-01
Childhood onset rheumatic disease FA20.Z Peripheral blood 3.60E-01 7.09E-02 3.51E-01
Chronic hepatitis C 1E51.1 Whole blood 3.87E-01 -8.23E-02 -5.69E-01
Chronic obstructive pulmonary disease CA22 Lung tissue 5.27E-01 -3.51E-02 -9.19E-02
Chronic obstructive pulmonary disease CA22 Small airway epithelium 9.27E-01 9.71E-03 3.89E-02
Chronic rhinosinusitis CA0A Sinus mucosa tissue 8.04E-02 1.30E-01 5.12E-01
Colon cancer 2B90 Colon tissue 6.68E-15 -6.07E-01 -9.71E-01
Coronary artery disease BA80-BA8Z Peripheral blood 4.58E-01 -1.63E-01 -7.12E-01
Diffuse large B-cell lymphoma 2A81 Tonsil tissue 5.70E-01 1.14E-01 3.22E-01
Endometriosis GA10 Endometrium tissue 3.92E-01 3.96E-03 1.01E-02
Familial hypercholesterolemia 5C80.00 Peripheral blood 3.84E-01 -1.23E-01 -7.06E-01
Familial hypercholesterolemia 5C80.00 Whole blood 1.29E-04 4.16E-01 1.23E+00
Gastric cancer 2B72 Gastric tissue 2.28E-02 7.69E-01 2.93E+00
Glioblastopma 2A00.00 Nervous tissue 1.48E-20 2.21E-01 5.04E-01
Glioma 2A00.0Y-2A00.0Z Brain stem tissue 4.53E-01 -2.62E-01 -7.55E-01
Glioma 2A00.0Y-2A00.0Z White matter tissue 6.67E-02 -3.02E-01 -8.28E-01
Head and neck cancer 2D42 Head and neck tissue 2.07E-33 6.47E-01 2.34E+00
HIV-associated neurocognitive impairment 8A2Y-8A2Z White matter tissue 6.48E-01 4.88E-03 1.90E-02
Huntington's disease 8A01.10 Whole blood 7.63E-01 9.86E-02 4.28E-01
Idiopathic pulmonary fibrosis CB03.4 Lung tissue 9.99E-01 1.32E-01 3.38E-01
Immunodeficiency 4A00-4A20 Peripheral blood 7.99E-01 -5.46E-02 -3.62E-01
Influenza 1E30 Whole blood 1.34E-01 -5.97E-01 -1.63E+00
Interstitial cystitis GC00.3 Bladder tissue 2.27E-02 3.11E-01 3.68E+00
Intracranial aneurysm 8B01.0 Intracranial artery 1.52E-09 9.32E-01 5.31E+00
Irritable bowel syndrome DD91.0 Rectal colon tissue 3.52E-04 -4.58E-01 -6.72E-01
Ischemic stroke 8B11 Peripheral blood 1.85E-01 -1.92E-01 -3.05E-01
Juvenile idiopathic arthritis FA24 Peripheral blood 6.93E-05 -2.04E-01 -4.06E-01
Lateral sclerosis 8B60.4 Skin 7.83E-01 5.12E-02 1.00E-01
Lateral sclerosis 8B60.4 Cervical spinal cord 1.89E-01 1.23E-01 4.39E-01
Liver cancer 2C12.0 Liver tissue 3.58E-06 -4.56E-01 -6.99E-01
Liver failure DB99.7-DB99.8 Liver tissue 3.65E-03 -1.77E+00 -2.10E+00
Lung cancer 2C25 Lung tissue 9.39E-01 -8.31E-02 -2.10E-01
Lupus erythematosus 4A40 Whole blood 9.32E-01 7.45E-02 1.86E-01
Major depressive disorder 6A70-6A7Z Hippocampus 4.74E-01 -7.93E-02 -3.91E-01
Major depressive disorder 6A70-6A7Z Whole blood 9.32E-01 -3.28E-02 -6.89E-02
Melanoma 2C30 Skin 1.46E-03 4.34E-01 8.33E-01
Multiple myeloma 2A83.1 Peripheral blood 3.76E-01 7.97E-02 3.79E-01
Multiple myeloma 2A83.1 Bone marrow 5.43E-03 -5.11E-01 -1.71E+00
Multiple sclerosis 8A40 Plasmacytoid dendritic cells 6.77E-01 -6.12E-02 -1.43E-01
Myelodysplastic syndrome 2A36-2A3Z Bone marrow 8.02E-01 3.08E-02 2.01E-01
Myelofibrosis 2A20.2 Whole blood 6.45E-01 -4.86E-02 -4.25E-01
Myocardial infarction BA41-BA50 Peripheral blood 8.88E-01 -5.57E-02 -9.67E-02
Myopathy 8C70.6 Muscle tissue 2.12E-01 6.67E-02 6.25E-01
Neonatal sepsis KA60 Whole blood 9.05E-01 8.90E-02 2.61E-01
Neuroectodermal tumour 2A00.11 Brain stem tissue 6.44E-01 -4.61E-02 -2.16E-01
Non-alcoholic fatty liver disease DB92 Liver tissue 6.05E-01 -4.01E-01 -5.78E-01
Obesity related type 2 diabetes 5A11 Omental adipose tissue 5.23E-01 7.87E-02 4.90E-01
Olive pollen allergy CA08.00 Peripheral blood 8.08E-01 4.32E-02 1.36E-01
Oral cancer 2B6E Oral tissue 7.34E-07 3.22E-01 9.59E-01
Osteoarthritis FA00-FA0Z Synovial tissue 2.51E-01 2.23E-01 4.90E-01
Osteoporosis FB83.1 Bone marrow 2.98E-01 4.28E-01 8.52E-01
Ovarian cancer 2C73 Ovarian tissue 3.31E-02 4.67E-01 1.20E+00
Pancreatic cancer 2C10 Pancreas 3.13E-06 5.53E-01 1.53E+00
Parkinson's disease 8A00.0 Substantia nigra tissue 2.40E-01 1.18E-01 5.07E-01
Pediatric respiratory syncytial virus infection CA40.11 Peripheral blood 6.43E-02 3.35E-01 1.13E+00
Pituitary cancer 2D12 Pituitary tissue 1.22E-02 3.93E-01 1.56E+00
Pituitary gonadotrope tumour 2D12 Pituitary tissue 1.80E-01 4.10E-01 9.71E-01
Polycystic ovary syndrome 5A80.1 Vastus lateralis muscle 4.47E-01 7.73E-02 5.44E-01
Polycythemia vera 2A20.4 Whole blood 2.93E-02 4.86E-02 3.90E-01
Pompe disease 5C51.3 Biceps muscle 2.32E-01 -6.60E-03 -2.49E-02
Preterm birth KA21.4Z Myometrium 6.08E-03 -3.67E-01 -1.84E+00
Prostate cancer 2C82 Prostate 8.06E-01 1.45E-01 2.23E-01
Psoriasis EA90 Skin 2.07E-07 2.57E-01 8.37E-01
Rectal cancer 2B92 Rectal colon tissue 2.35E-04 -9.50E-01 -3.18E+00
Renal cancer 2C90-2C91 Kidney 5.65E-03 -5.96E-01 -1.20E+00
Retinoblastoma 2D02.2 Uvea 3.32E-06 6.01E-01 2.39E+00
Rheumatoid arthritis FA20 Synovial tissue 2.70E-01 2.36E-01 9.75E-01
Rhinovirus infection CA42.1 Nasal epithelium tissue 1.30E-01 6.18E-02 4.07E-01
Schizophrenia 6A20 Prefrontal cortex 2.33E-01 6.05E-02 1.20E-01
Schizophrenia 6A20 Superior temporal cortex 6.63E-01 -1.99E-02 -2.07E-01
Scleroderma 4A42.Z Whole blood 9.48E-01 6.57E-02 2.60E-01
Seizure 8A60-8A6Z Whole blood 2.50E-01 -5.63E-02 -2.17E-01
Sensitive skin EK0Z Skin 1.69E-01 -4.34E-02 -3.55E-01
Sepsis with septic shock 1G41 Whole blood 4.46E-04 1.42E-01 5.22E-01
Shwachman-Diamond syndrome 3A70.0 Bone marrow 8.77E-02 3.06E-01 7.34E-01
Sickle cell disease 3A51.0-3A51.3 Peripheral blood 8.77E-01 -1.25E-01 -5.19E-01
Simpson golabi behmel syndrome LD2C Adipose tissue 4.17E-03 7.51E-01 4.08E+00
Sjogren's syndrome 4A43.2 Salivary gland tissue 1.43E-01 5.06E-02 1.90E+00
Skin cancer 2C30-2C3Z Skin 5.06E-19 3.83E-01 1.10E+00
Thrombocythemia 3B63 Whole blood 4.46E-02 3.64E-02 2.84E-01
Thrombocytopenia 3B64 Whole blood 7.10E-01 -3.43E-01 -3.73E-01
Thyroid cancer 2D10 Thyroid 4.21E-04 -2.07E-01 -3.09E-01
Tibial muscular dystrophy 8C75 Muscle tissue 1.68E-01 1.24E-01 5.47E-01
Tuberous sclerosis complex LD2D.2 Perituberal tissue 3.09E-01 2.47E-01 1.21E+00
Type 2 diabetes 5A11 Liver tissue 7.45E-02 -5.01E-01 -1.53E+00
Ureter cancer 2C92 Urothelium 7.70E-01 4.34E-02 1.51E-01
Uterine cancer 2C78 Endometrium tissue 5.18E-06 2.34E-01 4.53E-01
Vitiligo ED63.0 Skin 3.01E-01 1.74E-01 6.94E-01
------------------------------------------------------------------------------------
⏷ Show the Full List of DME Expression Under 107 Diseases