Details of Drug-Metabolizing Enzyme (DME)

General Information of Drug-Metabolizing Enzyme (DME) (ID: DEGSPC9)

• DME Name: Hydroxyacyl-CoA dehydrogenase 2 (HSD17B10)
• Synonyms: Endoplasmic reticulum-associated amyloid beta-peptide-binding protein; 17-beta-hydroxysteroid dehydrogenase 10; 2-methyl-3-hydroxybutyryl-CoA dehydrogenase; 3-hydroxy-2-methylbutyryl-CoA dehydrogenase; 3-hydroxyacyl-CoA dehydrogenase type II; 3-hydroxyacyl-CoA dehydrogenase type-2; Mitochondrial RNase P protein 2; Mitochondrial ribonuclease P protein 2; Short chain dehydrogenase/reductase family 5C member 1; Short-chain type dehydrogenase/reductase XH98G2; Type II HADH; 17-beta-HSD 10; XH98G2; ERAB; HADH2; HSD17B10; MHBD; MRPP2; SCHAD; SDR5C1
• Gene Name: HSD17B10
• UniProt ID: HCD2_HUMAN
• INTEDE ID: DME0471
• Gene ID: 3028
• EC Number:
  EC: 1.1.1.35
  Oxidoreductase
  CH-OH donor oxidoreductase
  NAD/NADP oxidoreductase
  EC: 1.1.1.35
• Lineage:
  Species: Homo sapiens
  Kingdom: Metazoa
  Phylum: Chordata
  Class: Mammalia
  Order: Primates
  Family: Hominidae
  Genus: Homo
  Species: Homo sapiens
• Sequence:
  MAAACRSVKGLVAVITGGASGLGLATAERLVGQGASAVLLDLPNSGGEAQAKKLGNNCVF
  APADVTSEKDVQTALALAKGKFGRVDVAVNCAGIAVASKTYNLKKGQTHTLEDFQRVLDV
  NLMGTFNVIRLVAGEMGQNEPDQGGQRGVIINTASVAAFEGQVGQAAYSASKGGIVGMTL
  PIARDLAPIGIRVMTIAPGLFGTPLLTSLPEKVCNFLASQVPFPSRLGDPAEYAHLVQAI
  IENPFLNGEVIRLDGAIRMQP
• Function: This enzyme catalyzes the beta-oxidation at position 17 of androgens and estrogens and has 3-alpha- hydroxysteroid dehydrogenase activity with androsterone. It catalyzes the third step in the beta-oxidation of fatty acids and carries out oxidative conversions of 7-alpha-OH and 7-beta-OH bile acids. It also exhibits 20-beta-OH and 21-OH dehydrogenase activities with C21 steroids.
• KEGG Pathway:
  Alzheimer's disease (hsa05010)
  Metabolic pathways (hsa01100)
  Valine, leucine and isoleucine degradation (hsa00280)
• Reactome Pathway:
  rRNA processing in the mitochondrion (R-HSA-8868766)
  tRNA modification in the mitochondrion (R-HSA-6787450)
  tRNA processing in the mitochondrion (R-HSA-6785470)
  Branched-chain amino acid catabolism (R-HSA-70895)

Molecular Interaction Atlas (MIA) of This DME

1 Approved Drug(s) Metabolized by This DME

Drug Name	Drug ID	Indication	ICD 11	Highest Status	REF
NADH	DM5NM6E	Parkinson disease	8A00.0	Approved	[1]

Experimental Enzyme Kinetic Data of Drugs

Drug Name	Indication	Highest Status	Kinetic Data	REF
NADH	Parkinson disease [8A00.0]	Approved	Km = 0.02 microM	[1]

Molecular Expression Atlas (MEA) of This DME

Disease Name	ICD 11	Studied Tissue	p-value	Fold-Change	Z-score
Acute myelocytic leukaemia	2B33.1	Bone marrow	7.67E-04	8.42E-02	2.40E-01
Alopecia	ED70	Skin from scalp	8.42E-02	-1.01E-01	-3.74E-01
Alzheimer's disease	8A20	Entorhinal cortex	8.77E-02	5.39E-02	1.92E-01
Ankylosing spondylitis	FA92.0	Pheripheral blood	3.29E-01	1.04E-01	5.38E-01
Aortic stenosis	BB70	Calcified aortic valve	7.21E-01	-1.74E-01	-1.64E-01
Apnea	7A40	Hyperplastic tonsil	9.88E-01	-9.47E-03	-3.02E-02
Arthropathy	FA00-FA5Z	Peripheral blood	2.21E-02	-1.81E-01	-9.29E-01
Asthma	CA23	Nasal and bronchial airway	9.87E-05	2.56E-01	3.32E-01
Atopic dermatitis	EA80	Skin	7.05E-03	-3.88E-02	-2.11E-01
Autism	6A02	Whole blood	3.38E-03	-2.32E-01	-7.01E-01
Autoimmune uveitis	9A96	Peripheral monocyte	1.25E-01	-2.28E-01	-1.40E+00
Autosomal dominant monocytopenia	4B04	Whole blood	6.38E-01	-2.60E-01	-9.28E-01
Bacterial infection of gingival	1C1H	Gingival tissue	9.45E-01	-3.09E-02	-1.38E-01
Batten disease	5C56.1	Whole blood	2.00E-01	-2.09E-01	-1.32E+00
Behcet's disease	4A62	Peripheral blood	7.58E-01	-1.12E-03	-4.09E-03
Bipolar disorder	6A60-6A6Z	Prefrontal cortex	5.07E-01	1.20E-03	4.45E-03
Bladder cancer	2C94	Bladder tissue	1.40E-06	5.94E-01	3.50E+00
Breast cancer	2C60-2C6Z	Breast tissue	2.21E-16	2.93E-01	6.85E-01
Cardioembolic stroke	8B11.20	Whole blood	1.62E-02	-1.68E-01	-7.39E-01
Cervical cancer	2C77	Cervical tissue	4.13E-02	-3.24E-01	-6.55E-01
Childhood onset rheumatic disease	FA20.Z	Peripheral blood	8.67E-01	-8.95E-02	-9.77E-02
Chronic hepatitis C	1E51.1	Whole blood	8.30E-01	-4.25E-02	-2.30E-01
Chronic obstructive pulmonary disease	CA22	Lung tissue	2.16E-01	-5.35E-02	-1.75E-01
Chronic obstructive pulmonary disease	CA22	Small airway epithelium	8.27E-01	1.01E-01	3.12E-01
Chronic rhinosinusitis	CA0A	Sinus mucosa tissue	5.19E-02	1.41E-01	9.08E-01
Colon cancer	2B90	Colon tissue	5.89E-47	4.67E-01	1.54E+00
Coronary artery disease	BA80-BA8Z	Peripheral blood	9.74E-05	1.09E+00	2.05E+01
Diffuse large B-cell lymphoma	2A81	Tonsil tissue	8.82E-01	-2.40E-01	-4.71E-01
Endometriosis	GA10	Endometrium tissue	2.44E-01	-1.06E-01	-4.39E-01
Familial hypercholesterolemia	5C80.00	Peripheral blood	5.83E-01	-6.58E-03	-3.93E-02
Familial hypercholesterolemia	5C80.00	Whole blood	1.49E-08	7.47E-01	1.79E+00
Gastric cancer	2B72	Gastric tissue	1.10E-01	2.72E-01	1.02E+00
Glioblastopma	2A00.00	Nervous tissue	1.50E-165	9.28E-01	2.29E+00
Glioma	2A00.0Y-2A00.0Z	Brain stem tissue	2.89E-01	-6.11E-02	-5.10E-01
Glioma	2A00.0Y-2A00.0Z	White matter tissue	4.73E-06	1.47E+00	2.41E+00
Head and neck cancer	2D42	Head and neck tissue	3.97E-02	4.96E-02	6.34E-02
HIV-associated neurocognitive impairment	8A2Y-8A2Z	White matter tissue	1.64E-01	2.78E-01	7.01E-01
Huntington's disease	8A01.10	Whole blood	6.93E-01	-1.55E-01	-5.10E-01
Idiopathic pulmonary fibrosis	CB03.4	Lung tissue	7.53E-01	-6.74E-03	-2.35E-02
Immunodeficiency	4A00-4A20	Peripheral blood	7.75E-03	2.81E-01	1.84E+00
Influenza	1E30	Whole blood	6.52E-01	1.04E-02	4.52E-02
Interstitial cystitis	GC00.3	Bladder tissue	7.57E-02	1.42E-01	1.02E+00
Intracranial aneurysm	8B01.0	Intracranial artery	9.41E-01	6.36E-02	2.53E-01
Irritable bowel syndrome	DD91.0	Rectal colon tissue	1.04E-01	-3.36E-01	-5.70E-01
Ischemic stroke	8B11	Peripheral blood	1.54E-01	-4.21E-02	-2.69E-01
Juvenile idiopathic arthritis	FA24	Peripheral blood	2.68E-11	-4.25E-01	-8.10E-01
Lateral sclerosis	8B60.4	Skin	5.76E-02	5.11E-01	1.38E+00
Lateral sclerosis	8B60.4	Cervical spinal cord	1.75E-01	-2.16E-01	-2.73E-01
Liver cancer	2C12.0	Liver tissue	2.56E-24	-6.92E-01	-2.65E+00
Liver failure	DB99.7-DB99.8	Liver tissue	1.87E-03	-1.17E+00	-3.94E+00
Lung cancer	2C25	Lung tissue	9.97E-71	5.37E-01	2.07E+00
Lupus erythematosus	4A40	Whole blood	3.73E-01	1.31E-01	2.29E-01
Major depressive disorder	6A70-6A7Z	Hippocampus	6.29E-01	2.04E-03	7.45E-03
Major depressive disorder	6A70-6A7Z	Whole blood	5.25E-01	-1.76E-01	-2.90E-01
Melanoma	2C30	Skin	3.55E-01	5.00E-02	1.04E-01
Multiple myeloma	2A83.1	Peripheral blood	3.94E-01	-3.63E-01	-5.49E-01
Multiple myeloma	2A83.1	Bone marrow	5.64E-07	1.12E+00	4.85E+00
Multiple sclerosis	8A40	Plasmacytoid dendritic cells	1.84E-01	1.56E-01	3.69E-01
Myelodysplastic syndrome	2A36-2A3Z	Bone marrow	5.61E-01	1.04E-01	3.86E-01
Myelofibrosis	2A20.2	Whole blood	4.93E-01	2.23E-02	9.97E-02
Myocardial infarction	BA41-BA50	Peripheral blood	8.60E-02	-1.41E-01	-1.98E-01
Myopathy	8C70.6	Muscle tissue	8.84E-03	1.06E-01	7.73E-01
Neonatal sepsis	KA60	Whole blood	7.70E-03	-2.34E-01	-7.24E-01
Neuroectodermal tumour	2A00.11	Brain stem tissue	4.03E-06	5.82E-01	2.72E+00
Non-alcoholic fatty liver disease	DB92	Liver tissue	9.82E-01	6.60E-02	2.70E-01
Obesity related type 2 diabetes	5A11	Omental adipose tissue	9.05E-01	-4.68E-02	-3.78E-01
Olive pollen allergy	CA08.00	Peripheral blood	3.61E-01	2.98E-01	5.52E-01
Oral cancer	2B6E	Oral tissue	1.61E-03	-2.87E-01	-7.44E-01
Osteoarthritis	FA00-FA0Z	Synovial tissue	3.87E-01	6.31E-02	3.01E-01
Osteoporosis	FB83.1	Bone marrow	2.66E-02	-8.88E-01	-1.60E+00
Ovarian cancer	2C73	Ovarian tissue	4.79E-03	4.80E-01	1.24E+00
Pancreatic cancer	2C10	Pancreas	3.62E-01	-7.71E-02	-2.91E-01
Parkinson's disease	8A00.0	Substantia nigra tissue	8.80E-02	-2.34E-01	-1.31E+00
Pediatric respiratory syncytial virus infection	CA40.11	Peripheral blood	3.49E-01	4.74E-02	1.49E-01
Pituitary cancer	2D12	Pituitary tissue	1.93E-01	6.84E-02	1.95E-01
Pituitary gonadotrope tumour	2D12	Pituitary tissue	9.18E-01	-9.43E-02	-2.49E-01
Polycystic ovary syndrome	5A80.1	Vastus lateralis muscle	7.90E-01	-2.20E-03	-1.56E-02
Polycythemia vera	2A20.4	Whole blood	1.56E-04	-1.73E-01	-8.01E-01
Pompe disease	5C51.3	Biceps muscle	1.31E-02	1.49E-01	7.89E-01
Preterm birth	KA21.4Z	Myometrium	6.93E-02	-1.90E-01	-7.00E-01
Prostate cancer	2C82	Prostate	2.61E-01	-4.10E-01	-5.76E-01
Psoriasis	EA90	Skin	1.60E-01	1.16E-01	5.32E-01
Rectal cancer	2B92	Rectal colon tissue	2.68E-01	4.69E-02	3.19E-01
Renal cancer	2C90-2C91	Kidney	5.52E-10	-6.97E-01	-4.49E+00
Retinoblastoma	2D02.2	Uvea	8.52E-11	1.10E+00	4.79E+00
Rheumatoid arthritis	FA20	Synovial tissue	4.02E-01	-1.76E-01	-7.01E-01
Rhinovirus infection	CA42.1	Nasal epithelium tissue	7.54E-01	3.98E-02	1.78E-01
Schizophrenia	6A20	Prefrontal cortex	2.07E-01	6.04E-02	9.26E-02
Schizophrenia	6A20	Superior temporal cortex	5.06E-01	-4.48E-03	-1.86E-02
Scleroderma	4A42.Z	Whole blood	2.96E-06	-4.12E-01	-3.00E+00
Seizure	8A60-8A6Z	Whole blood	7.29E-01	8.06E-02	2.11E-01
Sensitive skin	EK0Z	Skin	5.24E-01	1.50E-01	7.40E-01
Sepsis with septic shock	1G41	Whole blood	1.41E-08	-2.33E-01	-7.49E-01
Shwachman-Diamond syndrome	3A70.0	Bone marrow	2.14E-02	-1.29E-01	-1.35E+00
Sickle cell disease	3A51.0-3A51.3	Peripheral blood	1.83E-02	-3.50E-01	-8.35E-01
Simpson golabi behmel syndrome	LD2C	Adipose tissue	4.45E-01	-3.11E-01	-8.25E-01
Sjogren's syndrome	4A43.2	Salivary gland tissue	9.70E-01	2.49E-02	7.85E-02
Skin cancer	2C30-2C3Z	Skin	2.09E-06	-1.19E-01	-3.04E-01
Thrombocythemia	3B63	Whole blood	2.31E-01	2.35E-03	1.04E-02
Thrombocytopenia	3B64	Whole blood	5.23E-01	6.37E-01	4.57E-01
Thyroid cancer	2D10	Thyroid	1.42E-37	-6.65E-01	-2.60E+00
Tibial muscular dystrophy	8C75	Muscle tissue	1.98E-01	1.39E-01	5.34E-01
Tuberous sclerosis complex	LD2D.2	Perituberal tissue	5.39E-02	5.14E-01	1.46E+00
Type 2 diabetes	5A11	Liver tissue	6.51E-01	1.33E-01	9.60E-01
Ureter cancer	2C92	Urothelium	4.75E-01	1.86E-01	4.36E-01
Uterine cancer	2C78	Endometrium tissue	8.42E-01	6.88E-02	1.19E-01
Vitiligo	ED63.0	Skin	9.07E-01	9.59E-02	5.45E-01

References

• [1] A human brain L-3-hydroxyacyl-coenzyme A dehydrogenase is identical to an amyloid beta-peptide-binding protein involved in Alzheimer's disease. J Biol Chem. 1998 Apr 24;273(17):10741-6.