Details of Drug-Metabolizing Enzyme (DME)

General Information of Drug-Metabolizing Enzyme (DME) (ID: DEGTU5I)

DME Name Short-chain dehydrogenase/reductase retSDR8 (DHRS9)
Synonyms
Short chain dehydrogenase/reductase family 9C member 4; Retinol short-chain dehydrogenase/reductase 15; 3-alpha hydroxysteroid dehydrogenase; Dehydrogenase/reductase SDR family member 9; NADP-dependent retinol dehydrogenase/reductase; Retinol dehydrogenase 15; Tracheobronchial epithelial cell-specific retinol dehydrogenase; 3-alpha-HSD; SDR9C4; DHRS9; RDH-E2; RDH-TBE; RDH15; RDHL; UNQ835/PRO1773
Gene Name DHRS9
UniProt ID
DHRS9_HUMAN
INTEDE ID
DME0586
3D Structure
Download
2D Sequence (FASTA)
Download
3D Structure (PDB)
Download
Gene ID
10170
EC Number EC: 1.1.1.53
Oxidoreductase
CH-OH donor oxidoreductase
NAD/NADP oxidoreductase
EC: 1.1.1.53
Lineage Species: Homo sapiens
Kingdom: Metazoa
Phylum: Chordata
Class: Mammalia
Order: Primates
Family: Hominidae
Genus: Homo
Species: Homo sapiens
Sequence
MLFWVLGLLILCGFLWTRKGKLKIEDITDKYIFITGCDSGFGNLAARTFDKKGFHVIAAC
LTESGSTALKAETSERLRTVLLDVTDPENVKRTAQWVKNQVGEKGLWGLINNAGVPGVLA
PTDWLTLEDYREPIEVNLFGLISVTLNMLPLVKKAQGRVINVSSVGGRLAIVGGGYTPSK
YAVEGFNDSLRRDMKAFGVHVSCIEPGLFKTNLADPVKVIEKKLAIWEQLSPDIKQQYGE
GYIEKSLDKLKGNKSYVNMDLSPVVECMDHALTSLFPKTHYAAGKDAKIFWIPLSHMPAA
LQDFLLLKQKAELANPKAV
Function This enzyme converts 3-alpha-tetrahydroprogesterone (allopregnanolone) to dihydroxyprogesterone and 3-alpha-androstanediol to dihydroxyprogesterone.
KEGG Pathway
Metabolic pathways (hsa01100 )
Retinol metabolism (hsa00830 )
Reactome Pathway
The canonical retinoid cycle in rods (twilight vision) (R-HSA-2453902 )
RA biosynthesis pathway (R-HSA-5365859 )

Molecular Interaction Atlas (MIA) of This DME

Molecular Interaction Atlas (MIA) Jump to Detail Molecular Interaction Atlas of This DME
1 Approved Drug(s) Metabolized by This DME
Drug Name Drug ID Indication ICD 11 Highest Status REF
Vitamin A DMJ2AH4 Night blindness 9D45 Approved [1]

Molecular Expression Atlas (MEA) of This DME

Molecular Expression Atlas (MEA) Jump to Detail Molecular Expression Atlas of This DME
Disease Name ICD 11 Studied Tissue p-value Fold-Change Z-score
Acute myelocytic leukaemia 2B33.1 Bone marrow 4.41E-17 -1.23E+00 -1.08E+00
Alopecia ED70 Skin from scalp 3.04E-04 3.43E-01 5.66E-01
Alzheimer's disease 8A20 Entorhinal cortex 5.88E-02 9.42E-02 2.14E-01
Ankylosing spondylitis FA92.0 Pheripheral blood 7.46E-01 -1.02E-01 -2.09E-01
Aortic stenosis BB70 Calcified aortic valve 5.96E-01 2.20E-01 2.56E-01
Apnea 7A40 Hyperplastic tonsil 2.32E-01 1.46E+00 1.09E+00
Arthropathy FA00-FA5Z Peripheral blood 2.13E-01 5.03E-03 8.42E-03
Asthma CA23 Nasal and bronchial airway 5.94E-03 1.81E-01 3.37E-01
Atopic dermatitis EA80 Skin 7.70E-01 -2.29E-02 -3.25E-02
Autism 6A02 Whole blood 5.11E-01 -8.51E-03 -1.11E-02
Autoimmune uveitis 9A96 Peripheral monocyte 2.73E-01 8.60E-01 4.06E+00
Autosomal dominant monocytopenia 4B04 Whole blood 4.99E-02 5.81E-01 5.47E-01
Bacterial infection of gingival 1C1H Gingival tissue 6.09E-09 4.97E-01 7.31E-01
Batten disease 5C56.1 Whole blood 6.41E-01 3.23E-02 9.90E-02
Behcet's disease 4A62 Peripheral blood 1.52E-02 5.00E-01 8.57E-01
Bipolar disorder 6A60-6A6Z Prefrontal cortex 6.63E-02 -2.55E-01 -6.47E-01
Bladder cancer 2C94 Bladder tissue 7.39E-04 1.38E-01 5.86E-01
Breast cancer 2C60-2C6Z Breast tissue 1.49E-11 -3.72E-01 -4.14E-01
Cardioembolic stroke 8B11.20 Whole blood 1.60E-02 4.79E-01 7.20E-01
Cervical cancer 2C77 Cervical tissue 1.97E-02 -8.20E-01 -7.04E-01
Childhood onset rheumatic disease FA20.Z Peripheral blood 9.17E-01 4.73E-01 2.43E-01
Chronic hepatitis C 1E51.1 Whole blood 1.59E-02 1.19E-01 1.09E+00
Chronic obstructive pulmonary disease CA22 Lung tissue 6.99E-02 1.69E-01 3.53E-01
Chronic obstructive pulmonary disease CA22 Small airway epithelium 9.53E-02 -1.08E-01 -2.44E-01
Chronic rhinosinusitis CA0A Sinus mucosa tissue 9.14E-01 -7.20E-01 -5.57E-01
Colon cancer 2B90 Colon tissue 1.56E-143 -4.40E+00 -5.01E+00
Coronary artery disease BA80-BA8Z Peripheral blood 6.87E-01 -3.15E-01 -1.16E+00
Diffuse large B-cell lymphoma 2A81 Tonsil tissue 7.66E-01 5.60E-01 4.04E-01
Endometriosis GA10 Endometrium tissue 3.42E-03 2.77E-01 1.00E+00
Familial hypercholesterolemia 5C80.00 Peripheral blood 2.06E-01 -3.75E-02 -1.28E-01
Familial hypercholesterolemia 5C80.00 Whole blood 4.26E-01 -1.83E-01 -2.78E-01
Gastric cancer 2B72 Gastric tissue 7.34E-01 6.71E-03 4.51E-03
Glioblastopma 2A00.00 Nervous tissue 6.35E-04 -2.82E-01 -4.35E-01
Glioma 2A00.0Y-2A00.0Z Brain stem tissue 5.52E-01 -5.33E-01 -9.01E-01
Glioma 2A00.0Y-2A00.0Z White matter tissue 6.55E-02 -2.02E+00 -9.90E-01
Head and neck cancer 2D42 Head and neck tissue 4.80E-33 -3.05E+00 -1.86E+00
HIV-associated neurocognitive impairment 8A2Y-8A2Z White matter tissue 6.97E-02 -2.49E-01 -9.44E-01
Huntington's disease 8A01.10 Whole blood 2.44E-01 -2.19E-01 -4.94E-01
Idiopathic pulmonary fibrosis CB03.4 Lung tissue 9.17E-01 -2.19E-01 -2.62E-01
Immunodeficiency 4A00-4A20 Peripheral blood 1.29E-02 1.56E-01 3.53E+00
Influenza 1E30 Whole blood 4.56E-01 6.84E-01 9.06E-01
Interstitial cystitis GC00.3 Bladder tissue 4.13E-03 1.42E+00 1.46E+01
Intracranial aneurysm 8B01.0 Intracranial artery 3.67E-03 1.04E+00 1.95E+00
Irritable bowel syndrome DD91.0 Rectal colon tissue 9.20E-03 1.96E-01 3.35E-01
Ischemic stroke 8B11 Peripheral blood 5.88E-01 -1.12E-01 -2.20E-01
Juvenile idiopathic arthritis FA24 Peripheral blood 8.71E-02 -3.74E-01 -3.17E-01
Lateral sclerosis 8B60.4 Skin 9.28E-01 3.23E-02 2.28E-01
Lateral sclerosis 8B60.4 Cervical spinal cord 7.45E-01 1.40E-01 3.95E-01
Liver cancer 2C12.0 Liver tissue 2.10E-02 6.80E-03 1.92E-02
Liver failure DB99.7-DB99.8 Liver tissue 6.63E-06 1.67E+00 6.72E+00
Lung cancer 2C25 Lung tissue 2.79E-04 -2.16E-01 -2.99E-01
Lupus erythematosus 4A40 Whole blood 1.18E-15 1.22E+00 9.97E-01
Major depressive disorder 6A70-6A7Z Hippocampus 1.10E-01 -8.41E-02 -2.28E-01
Major depressive disorder 6A70-6A7Z Whole blood 3.30E-01 7.86E-02 1.24E-01
Melanoma 2C30 Skin 9.98E-03 -1.48E+00 -9.12E-01
Multiple myeloma 2A83.1 Peripheral blood 8.31E-03 1.80E-01 1.34E+00
Multiple myeloma 2A83.1 Bone marrow 3.42E-11 5.56E-01 3.06E+00
Multiple sclerosis 8A40 Plasmacytoid dendritic cells 2.70E-01 2.61E-01 4.99E-01
Myelodysplastic syndrome 2A36-2A3Z Bone marrow 3.23E-16 5.68E-01 2.09E+00
Myelofibrosis 2A20.2 Whole blood 1.50E-01 2.26E-01 4.59E-01
Myocardial infarction BA41-BA50 Peripheral blood 3.86E-01 7.67E-01 4.84E-01
Myopathy 8C70.6 Muscle tissue 2.53E-06 5.29E-01 4.27E+00
Neonatal sepsis KA60 Whole blood 7.23E-17 1.57E+00 1.93E+00
Neuroectodermal tumour 2A00.11 Brain stem tissue 3.64E-11 -2.37E+00 -6.60E+00
Non-alcoholic fatty liver disease DB92 Liver tissue 8.66E-02 3.26E-01 4.29E+00
Obesity related type 2 diabetes 5A11 Omental adipose tissue 6.74E-01 3.25E-01 5.74E-01
Olive pollen allergy CA08.00 Peripheral blood 1.88E-01 1.22E+00 1.06E+00
Oral cancer 2B6E Oral tissue 2.95E-01 -6.06E-01 -4.84E-01
Osteoarthritis FA00-FA0Z Synovial tissue 3.60E-01 -3.63E-01 -5.17E-01
Osteoporosis FB83.1 Bone marrow 3.34E-01 -1.12E-01 -1.40E-01
Ovarian cancer 2C73 Ovarian tissue 5.45E-04 8.65E-02 3.69E-01
Pancreatic cancer 2C10 Pancreas 7.12E-07 1.53E+00 1.85E+00
Parkinson's disease 8A00.0 Substantia nigra tissue 6.26E-01 3.64E-01 5.33E-01
Pediatric respiratory syncytial virus infection CA40.11 Peripheral blood 4.91E-05 8.25E-01 1.87E+00
Pituitary cancer 2D12 Pituitary tissue 9.29E-03 3.08E-01 8.21E-01
Pituitary gonadotrope tumour 2D12 Pituitary tissue 1.60E-03 1.01E+00 2.96E+00
Polycystic ovary syndrome 5A80.1 Vastus lateralis muscle 9.45E-01 7.30E-04 3.75E-03
Polycythemia vera 2A20.4 Whole blood 1.11E-01 -4.92E-02 -9.58E-02
Pompe disease 5C51.3 Biceps muscle 7.30E-03 1.78E+00 2.11E+00
Preterm birth KA21.4Z Myometrium 1.71E-01 -3.21E-01 -1.25E+00
Prostate cancer 2C82 Prostate 1.77E-01 -2.11E-01 -5.22E-01
Psoriasis EA90 Skin 1.46E-15 1.40E+00 1.71E+00
Rectal cancer 2B92 Rectal colon tissue 1.23E-07 -2.45E+00 -5.01E+00
Renal cancer 2C90-2C91 Kidney 1.16E-04 3.08E-01 9.75E-01
Retinoblastoma 2D02.2 Uvea 2.43E-01 -3.66E-01 -1.91E+00
Rheumatoid arthritis FA20 Synovial tissue 7.04E-01 9.93E-02 1.92E-01
Rhinovirus infection CA42.1 Nasal epithelium tissue 6.21E-01 -5.25E-02 -1.83E-01
Schizophrenia 6A20 Prefrontal cortex 2.60E-01 5.63E-02 1.18E-01
Schizophrenia 6A20 Superior temporal cortex 2.24E-01 3.05E-02 2.15E-01
Scleroderma 4A42.Z Whole blood 8.74E-02 4.28E-01 6.79E-01
Seizure 8A60-8A6Z Whole blood 1.82E-01 2.69E-01 2.30E-01
Sensitive skin EK0Z Skin 6.03E-01 8.40E-02 2.16E-01
Sepsis with septic shock 1G41 Whole blood 6.96E-88 2.37E+00 3.05E+00
Shwachman-Diamond syndrome 3A70.0 Bone marrow 1.51E-01 3.70E-01 5.48E-01
Sickle cell disease 3A51.0-3A51.3 Peripheral blood 5.49E-03 2.34E-01 1.60E+00
Simpson golabi behmel syndrome LD2C Adipose tissue 4.29E-01 1.40E-01 8.33E-01
Sjogren's syndrome 4A43.2 Salivary gland tissue 2.47E-03 9.06E-01 2.97E+00
Skin cancer 2C30-2C3Z Skin 1.11E-20 -7.33E-01 -7.78E-01
Thrombocythemia 3B63 Whole blood 7.66E-01 -5.36E-02 -1.07E-01
Thrombocytopenia 3B64 Whole blood 2.44E-01 4.93E-01 8.58E-01
Thyroid cancer 2D10 Thyroid 5.89E-03 4.96E-01 3.89E-01
Tibial muscular dystrophy 8C75 Muscle tissue 2.86E-06 6.69E-01 2.73E+00
Tuberous sclerosis complex LD2D.2 Perituberal tissue 2.90E-03 1.71E+00 3.35E+00
Type 2 diabetes 5A11 Liver tissue 9.10E-01 -5.09E-02 -2.07E-01
Ureter cancer 2C92 Urothelium 3.11E-01 2.12E-02 2.03E-02
Uterine cancer 2C78 Endometrium tissue 5.73E-03 3.11E-01 3.13E-01
Vitiligo ED63.0 Skin 4.16E-01 2.27E-01 3.22E-01
------------------------------------------------------------------------------------
⏷ Show the Full List of DME Expression Under 107 Diseases

References

1 Vitamin A metabolism by dendritic cells triggers an antimicrobial response against Mycobacterium tuberculosis. mSphere. 2019 Jun 5;4(3). pii: e00327-19.